SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357412873|ref|YP_004924609.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|357412873|ref|YP_004924609.1|
Domain Number - Region: 64-150
Classification Level Classification E-value
Superfamily Prim-pol domain 0.00105
Family Bifunctional DNA primase/polymerase N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357412873|ref|YP_004924609.1|
Sequence length 285
Comment bifunctional DNA primase/polymerase [Streptomyces flavogriseus ATCC 33331]
Sequence
MSTLLATALTLAARNVPVLPLRAGKLPFGNCPACAGNACGGRPSMKTAGPCQCPRPCHAW
AAATTDPATLTGPAWASAWRQTAAVAYHPGGTGLTVVDLDHADAITWARQTLPATRTVPT
TRGEHWIYRGAMQSANAVRDGVDVKSTMSYARWLGPGAGTMTRLPDAVRALVEREETTPA
RGGVVSSVPGRDQWDRSVATGCRHTERYVRTGLERGLALVRARTESGAGSQAFGVAQFLA
KQHATCPGPCGLDLVGQQLVATAVSVGVPEPYASRAVANGLAGAA
Download sequence
Identical sequences E8W1K9
WP_014155710.1.77427 gi|357412873|ref|YP_004924609.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]