SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357413191|ref|YP_004924927.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|357413191|ref|YP_004924927.1|
Domain Number - Region: 240-270
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 0.000965
Family Intron-encoded homing endonucleases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|357413191|ref|YP_004924927.1|
Sequence length 291
Comment HNH endonuclease [Streptomyces flavogriseus ATCC 33331]
Sequence
MSDQNKYPRDLLARTAAASTSLVDLLGRLGAPLGSGPLRYVRDRLKLYGIDTTHFVDDAL
PERQKRSYTRELLEEAAAHAHSIREMLEYMNVPPEDGPYGYIRKRLDRLGIDTSHFTNGR
RYGSSLAPRHELTSAVAKSKSLAGVLKLLGQTNNGAARARLKRSLAEYGLSTAHFTGQGH
TRGSSSPHRKAASEILQRRESGATRTRTTLLRRALVEIGRPRVCSACGIGDTWQGKRLVL
EIDHISGDHLDNRRENLRYLCPSCHSQTATFSKRRRPTQYSSETRARTPAG
Download sequence
Identical sequences E8W6Q5
WP_014156024.1.34797 WP_014156024.1.77427 gi|357413191|ref|YP_004924927.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]