SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357414330|ref|YP_004926066.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357414330|ref|YP_004926066.1|
Domain Number 1 Region: 21-218
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.33e-25
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357414330|ref|YP_004926066.1|
Sequence length 221
Comment cytochrome b/b6 protein [Streptomyces flavogriseus ATCC 33331]
Sequence
MTSTPGSAGPTAATTPPPSDPSPRVRRFTTAERLVHRATAWLVLICVATAACLYVPQLAE
LVGRRRLVVTVHEWSGLLIPVPLLAGLASRALRADLSRINRFGPHDRRWLRAALRRDHAP
GSRPAGKFNAGQKLYAAWTAGAVLVMLGTGLLMWFTGLAPLVWRTGATFVHDWLALALGV
VVAGHMAKALADPEARRGMRTGSVERLWARSEHPLWRETEE
Download sequence
Identical sequences E8W5S0
gi|357414330|ref|YP_004926066.1| WP_014157158.1.77427 WP_014157158.1.77540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]