SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357414453|ref|YP_004926189.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|357414453|ref|YP_004926189.1|
Domain Number - Region: 9-86
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.018
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|357414453|ref|YP_004926189.1|
Sequence length 119
Comment hypothetical protein Sfla_5275 [Streptomyces flavogriseus ATCC 33331]
Sequence
MLDALTVAVAVTALALAAWCGFAAYRDQPTKDWHFIGMAVVSVLALAQLVVGIVQLARGE
RPEQGMTIFIAYLIGAAAAVPAAGFLSLTERTRWGSVTVAAGAVVLAVLEVRLYDIWGN
Download sequence
Identical sequences E8W864
gi|357414453|ref|YP_004926189.1| WP_014157279.1.77427 WP_014157279.1.8887 WP_014157279.1.98132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]