SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|357415125|ref|YP_004926861.1| from Streptomyces flavogriseus ATCC 33331

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|357415125|ref|YP_004926861.1|
Domain Number 1 Region: 275-420
Classification Level Classification E-value
Superfamily Oxidoreductase molybdopterin-binding domain 1.7e-32
Family Oxidoreductase molybdopterin-binding domain 0.00038
Further Details:      
 
Weak hits

Sequence:  gi|357415125|ref|YP_004926861.1|
Domain Number - Region: 78-191
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0105
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|357415125|ref|YP_004926861.1|
Sequence length 423
Comment oxidoreductase molybdopterin binding protein [Streptomyces flavogriseus ATCC 33331]
Sequence
MGDRRQRTAPHLPRAPFPLPTGPAFWRSPVRGVRFTAVLGVVLLAGITLLFVTGLLSYAA
YNPDLAAVNDKTPAKGLLGFYLFDWPTGPHWLYRLTQGLHVTVGIVLVPVLLAKLWSVVP
KLFALPPARSAGHALERCSVLLLVGGALFQFVTGLLNIQLEYLFPGSFYPLHFYGAWVFF
AAFLTHTFLKLPRALRVLRRGLPAAQDELASPAPAAETVSRRGALAVVGAGSLLLLVTSA
GRSFDGGVRQTALLTPRGGAEPGTGPNGFQINKTAAHVGVTPAETGADWRLTVVGPAGET
QLSRAQLLSMGQHSAALPIACVEGWSTSDQWWRGVRLRDLAALAGFPEDPPGVLVESLQR
SGPFRSVALRDNQVRDPHSLLALAVNGEDLSPDHGFPARVIVPAAPGVMNTKWVGRLTFG
ELR
Download sequence
Identical sequences E8VZP7
WP_014157946.1.77427 gi|357415125|ref|YP_004926861.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]