SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|260845893|ref|YP_003223671.1| from Escherichia coli O103:H2 str. 12009

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|260845893|ref|YP_003223671.1|
Domain Number 1 Region: 1-362
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.38e-110
Family FMN-linked oxidoreductases 0.00000000000998
Further Details:      
 
Domain Number 2 Region: 333-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.06e-41
Family N-terminal domain of adrenodoxin reductase-like 0.00000032
Further Details:      
 
Domain Number 3 Region: 467-627
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.67e-27
Family C-terminal domain of adrenodoxin reductase-like 0.0000000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|260845893|ref|YP_003223671.1|
Sequence length 672
Comment 2,4-dienoyl-CoA reductase, NADH and FMN-linked [Escherichia coli O103:H2 str. 12009]
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFTWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYHRMIEVTGVTLKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIARFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKPGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI
Download sequence
Identical sequences A0A099AVH6 C8TX75 E0IVS7 I2X288
gi|386710984|ref|YP_006174705.1| gi|378711463|ref|YP_005276356.1| gi|386710984|ref|YP_006174705.1| WP_000121461.1.100252 WP_000121461.1.100283 WP_000121461.1.101257 WP_000121461.1.101865 WP_000121461.1.10379 WP_000121461.1.10400 WP_000121461.1.1073 WP_000121461.1.1074 WP_000121461.1.10940 WP_000121461.1.11748 WP_000121461.1.12279 WP_000121461.1.12342 WP_000121461.1.1242 WP_000121461.1.12762 WP_000121461.1.1315 WP_000121461.1.13162 WP_000121461.1.13495 WP_000121461.1.14062 WP_000121461.1.14417 WP_000121461.1.14672 WP_000121461.1.15087 WP_000121461.1.15282 WP_000121461.1.15300 WP_000121461.1.15332 WP_000121461.1.15983 WP_000121461.1.1621 WP_000121461.1.17392 WP_000121461.1.17417 WP_000121461.1.18175 WP_000121461.1.18410 WP_000121461.1.188 WP_000121461.1.18923 WP_000121461.1.19297 WP_000121461.1.19397 WP_000121461.1.20662 WP_000121461.1.21519 WP_000121461.1.21812 WP_000121461.1.21948 WP_000121461.1.22662 WP_000121461.1.23135 WP_000121461.1.24122 WP_000121461.1.2430 WP_000121461.1.24642 WP_000121461.1.24650 WP_000121461.1.2479 WP_000121461.1.24929 WP_000121461.1.25414 WP_000121461.1.25548 WP_000121461.1.26061 WP_000121461.1.26943 WP_000121461.1.27019 WP_000121461.1.27234 WP_000121461.1.27723 WP_000121461.1.2811 WP_000121461.1.29590 WP_000121461.1.30105 WP_000121461.1.32184 WP_000121461.1.32406 WP_000121461.1.33914 WP_000121461.1.34206 WP_000121461.1.35464 WP_000121461.1.35934 WP_000121461.1.39636 WP_000121461.1.39780 WP_000121461.1.40781 WP_000121461.1.41263 WP_000121461.1.41287 WP_000121461.1.41712 WP_000121461.1.41740 WP_000121461.1.41784 WP_000121461.1.42749 WP_000121461.1.42937 WP_000121461.1.43132 WP_000121461.1.43642 WP_000121461.1.43750 WP_000121461.1.44961 WP_000121461.1.45600 WP_000121461.1.45865 WP_000121461.1.46027 WP_000121461.1.47246 WP_000121461.1.47398 WP_000121461.1.47976 WP_000121461.1.48480 WP_000121461.1.48921 WP_000121461.1.4949 WP_000121461.1.49546 WP_000121461.1.50207 WP_000121461.1.51405 WP_000121461.1.51427 WP_000121461.1.5157 WP_000121461.1.51839 WP_000121461.1.51985 WP_000121461.1.52662 WP_000121461.1.52710 WP_000121461.1.52735 WP_000121461.1.5362 WP_000121461.1.53642 WP_000121461.1.54688 WP_000121461.1.54725 WP_000121461.1.54729 WP_000121461.1.55757 WP_000121461.1.56216 WP_000121461.1.56231 WP_000121461.1.56399 WP_000121461.1.56439 WP_000121461.1.56665 WP_000121461.1.5748 WP_000121461.1.57920 WP_000121461.1.58289 WP_000121461.1.58870 WP_000121461.1.59199 WP_000121461.1.59877 WP_000121461.1.62973 WP_000121461.1.63470 WP_000121461.1.63484 WP_000121461.1.63746 WP_000121461.1.64286 WP_000121461.1.65305 WP_000121461.1.65581 WP_000121461.1.65708 WP_000121461.1.66412 WP_000121461.1.67663 WP_000121461.1.68241 WP_000121461.1.68255 WP_000121461.1.68442 WP_000121461.1.68673 WP_000121461.1.68678 WP_000121461.1.69689 WP_000121461.1.70213 WP_000121461.1.70414 WP_000121461.1.70745 WP_000121461.1.71162 WP_000121461.1.71327 WP_000121461.1.71537 WP_000121461.1.71680 WP_000121461.1.71767 WP_000121461.1.72013 WP_000121461.1.72125 WP_000121461.1.72141 WP_000121461.1.72261 WP_000121461.1.72493 WP_000121461.1.72535 WP_000121461.1.73010 WP_000121461.1.73239 WP_000121461.1.73428 WP_000121461.1.73468 WP_000121461.1.73827 WP_000121461.1.74444 WP_000121461.1.74624 WP_000121461.1.74885 WP_000121461.1.75112 WP_000121461.1.75629 WP_000121461.1.7603 WP_000121461.1.76036 WP_000121461.1.76103 WP_000121461.1.76387 WP_000121461.1.76619 WP_000121461.1.7699 WP_000121461.1.77495 WP_000121461.1.78683 WP_000121461.1.79343 WP_000121461.1.80176 WP_000121461.1.80753 WP_000121461.1.80894 WP_000121461.1.83947 WP_000121461.1.84436 WP_000121461.1.84473 WP_000121461.1.85129 WP_000121461.1.85342 WP_000121461.1.85435 WP_000121461.1.86115 WP_000121461.1.86181 WP_000121461.1.87310 WP_000121461.1.87410 WP_000121461.1.88252 WP_000121461.1.88384 WP_000121461.1.88759 WP_000121461.1.88883 WP_000121461.1.89050 WP_000121461.1.89183 WP_000121461.1.8938 WP_000121461.1.89474 WP_000121461.1.90156 WP_000121461.1.90405 WP_000121461.1.90822 WP_000121461.1.91094 WP_000121461.1.9160 WP_000121461.1.92163 WP_000121461.1.93033 WP_000121461.1.93463 WP_000121461.1.93531 WP_000121461.1.93665 WP_000121461.1.93745 WP_000121461.1.94475 WP_000121461.1.94580 WP_000121461.1.95022 WP_000121461.1.96229 WP_000121461.1.96541 WP_000121461.1.96562 WP_000121461.1.98139 WP_000121461.1.9817 WP_000121461.1.98400 WP_000121461.1.98683 WP_000121461.1.98988 WP_000121461.1.99029 WP_000121461.1.99168 WP_000121461.1.99295 gi|260845893|ref|YP_003223671.1| gi|378711463|ref|YP_005276356.1| gi|544391572|ref|YP_008566244.1| 585395.ECO103_3826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]