SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|299771035|ref|YP_003733061.1| from Acinetobacter oleivorans DR1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|299771035|ref|YP_003733061.1|
Domain Number 1 Region: 2-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.54e-108
Family FMN-linked oxidoreductases 0.00000000852
Further Details:      
 
Domain Number 2 Region: 334-518
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 2.71e-40
Family N-terminal domain of adrenodoxin reductase-like 0.0000202
Further Details:      
 
Domain Number 3 Region: 471-630
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000166
Family C-terminal domain of adrenodoxin reductase-like 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|299771035|ref|YP_003733061.1|
Sequence length 676
Comment 2,4-dienoyl-CoA reductase (NADPH) [Acinetobacter oleivorans DR1]
Sequence
MTSYANLLKPLHLGFTTIKNRVVMGSMHTGLEDRFFNYPKLAAYFEERAKGGVGLIVTGG
ISPNRQGWLAPAGGTMNSLFDVPQHRLVTHAVHKHGSKILMQILHAGRYGYQPFVVSSTA
IKSPISPFKPRQLSEKNILSTIEDYAQCADIAKKAGYDGVEIMGSEGYLINQFLSSHVNQ
RTDRWGGGIENRMRFPVEIVKAIRAKVGEKFIICFRLSLLDLVHDGNTMQEVVTVAKALE
KAGVTLLNTGIGWHEARVPTIVTSVPRAAFVDYTAHVKQHISIPIIASNRINMPETAEEI
LATGKADMVQMARPLLADAFWVNKTATNRVDEINTCIACNQACLDHAFKNKRVSCLVNPR
AGHETELVYLKTKQPKRIAVVGGGVAGMSAATVAASRGHAVTLFEATSDVGGQFNFAKVV
PGKEEFHETIRYFKVQLEKTGVDVRLNTRVNREQLEREGFDEVIVATGVIPRALKIEGSN
APQVLSYAQVLKGAEVGQKVAVIGAGGIGFDVSEFLLKPPHQPQPQPLAEWQREWGVDPD
PNYVSEGGMQPPVVEPAIREIYLLQRKTTPLGIGLGKTSGWVHRAQLKKHGVRMLRGVQY
KAVTDEGLWIEHNGQDQLLRVDTIVVCAGQESVKDLMPKEGESTIANYHIIGGAKLAAEL
DAKRAIKEGAELAARL
Download sequence
Identical sequences D8JPB4
WP_013198573.1.101907 WP_013198573.1.18184 WP_013198573.1.279 gi|299771035|ref|YP_003733061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]