SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302873068|ref|YP_003841701.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873068|ref|YP_003841701.1|
Domain Number 1 Region: 104-293,329-474
Classification Level Classification E-value
Superfamily L domain-like 7.25e-32
Family Internalin LRR domain 0.063
Further Details:      
 
Domain Number 2 Region: 628-790
Classification Level Classification E-value
Superfamily L domain-like 3.4e-23
Family Ngr ectodomain-like 0.095
Further Details:      
 
Domain Number 3 Region: 817-895
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 5.1e-18
Family Invasin/intimin cell-adhesion fragments 0.0034
Further Details:      
 
Domain Number 4 Region: 515-594
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 7.06e-18
Family Invasin/intimin cell-adhesion fragments 0.0036
Further Details:      
 
Domain Number 5 Region: 899-954
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.000000000000262
Family Type I dockerin domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302873068|ref|YP_003841701.1|
Sequence length 955
Comment Ig domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MLRGNKKFISKVLLVSMCTSLTPTTLTFAVDNVNVQNTGTSVVQTTDAPNAASDFLFDSA
TGKITKYTGPDTTVVIPSEINGVTVKGIGAEAFSYNKDLISVEIPDTVTIIGSRAFYNCF
GLTSVKLPSNLATIENSTFENCTSLSGIDIPSSVTSIGNSAFWSCESLTSVSIPNGVKVI
GSSAFEHCQKIKTITIPATVTSIGSGAFWSCKALTSLVIPEGVTNIESYTFYDCNSLTSV
TLPSSLTSIGTNAFKYCNTLPSIDVPAKVASIAPDSFINCTSLKSINVNANNSTFTSVDG
VLFNKAKTEILRCPEGVTNATYTIPSSVTSIGIHAFENCANLVTINVPSTITNIGEHAFI
NCKSLANVRIPYGIKIIDDFTFYGCSSLVNIKVPDTVTVIGEEAFSNCTSLASMDLPNSV
VTIEAIAFSRCKSLTTFRVPYSVVSIEKFAFQECDKLETIYIPDNVKTFQKWVFINTNKA
VFHVESEILKQRVINTGVDESRIVVDVPTGPVSARSVTLSNTNLTILKGDSTLIATEILP
YVSTNKTLSWKSSNPAVATVDQNGKVAAVGLGTATITCTTTDGSNLSTSASVAVSEDPKL
FFNFDATTGTITKYIGTDTSIIIPSAINGVPVTKIANNAFENCTTITDVKIPSGVTSIGS
YAFQNCTNLISVEVPSTVTTIGQNAFGMCSSLKNINLPSSITSIADYTFAYCSSLTSITI
PNTVTAINAYAFYGCSSLSNLIIPDKVTTIGEHAFRVCSGLTSLTVPNSVTSIATGAFTG
CSNAKFYITSDAVKQLLLNNGVYKIRIVLNGQFLAKEVTSVTLNSTSLVINNGATSKLTA
TILPGDADSTVTWKSSDPYIATVDSNGVVTIKSVGKATITCTAADGSGKFATCEVEGKLV
GDVNNDGYASALDLVILKSYLLDNTVSIDKERADLNNDSKINVIDAALLKKILLS
Download sequence
Identical sequences A0A173N051 D9SNR6
WP_010075307.1.47838 gi|302873068|ref|YP_003841701.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]