SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302873542|ref|YP_003842175.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873542|ref|YP_003842175.1|
Domain Number 1 Region: 55-167,234-401
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000141
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 
Domain Number 2 Region: 417-511
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000191
Family Fibronectin type III 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302873542|ref|YP_003842175.1|
Sequence length 1235
Comment fibronectin type III domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MCNLSTMQKKVIHSNNLNRKLLLLPKTLLLLMFFGLLFSFIHSYDTYAVEPTIQWEKTIL
EGYTSSDMHPTSDGGFVITGSIPINGAPGTYSNVFVCKFNSLGNIEWTNNYGLETHDEWG
NKIIQTKDGGYLILGSRSKSSFATYDPTTKQWIHDIIFDIPNTMYIAKLNSLGQLQWQQE
VGYNLCVENTAIVETDDSGFLICGQEGGGFYCGPLYTNLLKLTSQGTVQFSKQLSQLFPV
TSLNKTTDGGYILSGFNNGLFILKLDSSYNENWNSTITLSDEASYNYKTSVIETSTGFSV
AGVGSNSILVSLDKSGQILWNKTYVNGNSYRANSVKGTIDSGYFFGVNTTPQGTVTNIAL
YKVDSNGDKQFEKQLTVNNEELSAVCPTKNDSYIVATNYSKNGKNSIHLMNLSCKPPTPN
VKIVDTTDTSTMINIQDSNLENTLYQIKINNSYCTSKGSLTTEPTWISLDKKKVSIIGLL
PNTSYNITAKARNVNGLESLNSASVTFTTLTTEAAAYKQQLLATTNAVIKAETSKMQIDL
LRATSLVDLLPDSTDKTNLSNRLVAVQNSIDLNYATNAVVKAEATKQQIYVERALSLVDI
LPDSIDKVNLLNRLVLVQNTIDLANATNLVINAETTKQQIDIYIAINVVNDLPDSTDKTN
LLNRLVSVQNNINNSTNLTIAINAVIMAETTKQQSDVSIAQSLVEGLKSETDKANLLNRL
SLVQSAINLTSATNLVIKAEESKQQIDVVIAKNLVDVLPNSSDKTTLSNRLLSIQNSIND
GITLDNAIKAVIKAEESNLQADVDRSKGLVEALPDSSDKTNLLDRLLVVQASIDNAIGAV
EKAEETKLQEDVDKATALVNKLQSSEDKIKLKNRLVVIQNILDLNSVTNAVILAEESKGQ
LYVDKANSLVSKLQDSIDKLNLVKRLTIVQGYINLSNAQIAVAKAEASLQQADLDSAKTL
AVALPISIDRSNLLNRLVNVQYSVNLANARTAVNIAEGSKLQANLDAAVNLVNALPSSSN
KTDLLNRLVSLQNTINLANATNAVSKAEATNVQSDVDAAKELVVNLPASTGRTNLLNRLT
VVQNKINLIIATNTVAKAEVTRLQADVDAAQNLVIQLPSSAEKTNLLNRLVNVQYKIDSA
NATNTVIKAEGSKQQADVDTAITLVNSLANSTTKTNLLNRLSSVQNMINLTNAIVKAEES
KSQADMNLAQSYIDKLPSDDINRTIFQQRLALIKA
Download sequence
Identical sequences D9SRP4
WP_010074809.1.47838 gi|302873542|ref|YP_003842175.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]