SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302873618|ref|YP_003842251.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873618|ref|YP_003842251.1|
Domain Number 1 Region: 15-154
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.63e-28
Family N-acetyl transferase, NAT 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302873618|ref|YP_003842251.1|
Sequence length 158
Comment N-acetyltransferase GCN5 [Clostridium cellulovorans 743B]
Sequence
MREHYPQKLSLKINMIRQAILEDSRIAAQLAMLLWPDNEISQLEEDMKEYIDSNNGAVFI
YFDETTPVGFAQCGLRHDYVEGTQSSPVGYLEGIFVKEEYQRRCIAKKLLAQCEEWAKAQ
GCSEFASDCELTNIDSLKFHLQIGFEETNRIICFKKKL
Download sequence
Identical sequences D9SRX0
WP_010074731.1.47838 gi|302873618|ref|YP_003842251.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]