SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302873907|ref|YP_003842540.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302873907|ref|YP_003842540.1|
Domain Number 1 Region: 295-428
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.12e-32
Family Cellulose-binding domain family III 0.0024
Further Details:      
 
Domain Number 2 Region: 213-292
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 1.96e-18
Family Invasin/intimin cell-adhesion fragments 0.0057
Further Details:      
 
Domain Number 3 Region: 37-201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-18
Family SPRY domain 0.031
Further Details:      
 
Weak hits

Sequence:  gi|302873907|ref|YP_003842540.1|
Domain Number - Region: 430-492
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0373
Family Type I dockerin domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302873907|ref|YP_003842540.1|
Sequence length 494
Comment Ig domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MKNKRFKKLRNSLIAVMSIAVLVLASSNIFATSTVGATTWDPANKASNVTLSNDNLTTAF
GGNVGNVKATNYKISGKWYWELKIISSSCELVGVANELFNVTKDNGTSNNQLSYYGYGST
IYPGIKGYGESFAGGDIISIALDIDNKKIRFAKNGKWFSDINLPAWNQYYPFVTFGSSSG
GGVQTTNFGASPFAYQAPVGFSPFDNTPIETASTSISLNKSTTNLNVEETESLVATITPS
EATNKNIIWTSSDTAIATVDTAGKITAIKEGQATIIAKIENTDITATCIVDVTATKETVT
VESEKTKIPANQEFTTDIVLHNAKDTFAEDVKINYDKDLFEYVGYEDIEGLKVYKEIKNP
ETGDLRFIIASQGETNGINADKTLVKLKFKTKGSGKGKVDVIATRIADNAGTENDLLTEN
CGEKEFEVFTDVNNTGDFTLGDLAIDGYYYGKNVSDTDKVKYNADVVVNEKIDDEDLTEI
TSQIIGNSKYTPNN
Download sequence
Identical sequences D9STT8
WP_010076377.1.47838 gi|302873907|ref|YP_003842540.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]