SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302874309|ref|YP_003842942.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302874309|ref|YP_003842942.1|
Domain Number 1 Region: 676-871
Classification Level Classification E-value
Superfamily L domain-like 5.44e-25
Family Internalin LRR domain 0.048
Further Details:      
 
Domain Number 2 Region: 247-516
Classification Level Classification E-value
Superfamily L domain-like 1.45e-21
Family Ngr ectodomain-like 0.026
Further Details:      
 
Domain Number 3 Region: 551-631
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 1.02e-18
Family Invasin/intimin cell-adhesion fragments 0.0049
Further Details:      
 
Domain Number 4 Region: 921-999
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 2.24e-17
Family Invasin/intimin cell-adhesion fragments 0.0035
Further Details:      
 
Domain Number 5 Region: 1008-1064
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000000000000445
Family Type I dockerin domain 0.00066
Further Details:      
 
Domain Number 6 Region: 107-222
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000181
Family Ngr ectodomain-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302874309|ref|YP_003842942.1|
Sequence length 1065
Comment Ig domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MKIKKKLISKMLVLVMCTSYTPTMKVFAEESKVVDQVTTSVIEKTEEIGVSNDKNNTEEI
ANPESDFAFNANIGEITGYYGEDTTVVIPSTIRGESVKSIGEMAFSSSWRKTANIESISI
PEGVTDIKRYAFQRCANLKSIRIPNSTTVIYDNAFENCESLTDIVIPNGVRGLGAYVFSG
CSSIETINIPTSICDIGAGAFRNCSKLKDIIVDNNNWYYTSDDGVLFNKSKNTVIKYPEG
KYSESYLIPDSVINIGNYAFEYCSELKSVTIQNSVTDIGSGAFYYAKALTTVDIPNSVTK
IGDDAFDGCSSLIGVTIPNSVTSIGANLFWRCSSLTNVKLPDGITNIPNNTFAECNSLKN
IVIPSGVTSIGSSAFSYSGLTDVVIPDTVRTIGSWGFASCHDLASITIPDSVTTIKERAF
QACYMLTSISIPRGIRTIESGAFEHCKSLKNVVIPENITEIRDTAFQYCSNLTNVTISYG
VTSIGNYAFQFCDKLERIEIPDTTASISTNAFVSCPNVIFYVESNEEKQILINSGISDNK
ITVELQSEEGLVRSIILDNANVTLLNGYSLTLNAEVLPYNAKNKTLSWKSSNSDVAIVDE
TGKVTAVGLGKATITCTANDGSNQTATCLVITTDNYDSKFKFNQVTGTIEDYVGNDTVLV
VPRTINGVLVTKIGNNAFNSCSDLNTIEIPNSITSIGDYAFNKCINLKNIVMPDSITSIG
EDAFYKCINLKNITIPSSVTNIKRYAFSNCSSLESIVIPDSITTIEIGTFRECTNLETVS
IPNSVTSIGSSAFFRCISLTNITIPSSATSIGSGAFCGCTGLKNVVLPNLQEISDNVFNH
CTSLIGIIIPESVTNIGPYAFTNCDSLKYVIVPSTVKSIGKGAFENCNETMFYVDSMEEI
NLLCNNGSSGDKIQLASELPKINLTLSKTTLDMSTKQTETLVATILPKCITKNVSWESSN
PDVASVDETGKITAIGEGTATITCSTTDGSNQSATCLVTSKEVLVNEFLGDVDSNEKVNV
IDAALLKKYILNSSTVINLANADINGDGKVNAIDLVLLKKMILEK
Download sequence
Identical sequences A0A173N032 D9SW34
gi|302874309|ref|YP_003842942.1| WP_010075955.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]