SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302876085|ref|YP_003844718.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302876085|ref|YP_003844718.1|
Domain Number 1 Region: 211-303
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000151
Family N-acetyl transferase, NAT 0.018
Further Details:      
 
Weak hits

Sequence:  gi|302876085|ref|YP_003844718.1|
Domain Number - Region: 1-83
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00101
Family N-acetyl transferase, NAT 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302876085|ref|YP_003844718.1|
Sequence length 308
Comment N-acetyltransferase GCN5 [Clostridium cellulovorans 743B]
Sequence
MSITFRYYTDEDFLKLEELILASYQWGKPIWSFSRHEFCRGVHSAWANVKDNWRHTVGIW
EEDGKIISAVICEGVWHGDAFFLFDSLERQKDSKLLEKMFHHAETHLSCFTNDYKEQSRY
LHIVIPKEYSCVKNMAKERGYGLSQHTERSLILPFRGDKFDVVLPEGYRIADGNETPDFF
LSNTHMFSFNYTLPIAETGEKGFHDLRTMPGYKPELDLCVLDQEGKPVGMAIIWYNEKMP
YCELEPLGVVWWSRRKGVARALIYEAANRIMKIAPSCRGMLGGDQQFYWDLGFKVETTYE
TWDWSRKF
Download sequence
Identical sequences D9SUX9
WP_010073342.1.47838 gi|302876085|ref|YP_003844718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]