SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302876107|ref|YP_003844740.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302876107|ref|YP_003844740.1|
Domain Number 1 Region: 5-151
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000000108
Family N-acetyl transferase, NAT 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302876107|ref|YP_003844740.1|
Sequence length 155
Comment N-acetyltransferase GCN5 [Clostridium cellulovorans 743B]
Sequence
MIDKNIKIISLHEKPQLANEVIDYANKNWPPISKYFTEVVQQVLDTDESLPKCFILLKNQ
RIIGLYTLVNQDLVERKDLSPWIAMIFIDEKERAQGLCKEILLHGRRIAGDLGFDKVYLS
TNHIGLYEKYGFKEIALDMFVWGRPAKIYEHSSIS
Download sequence
Identical sequences D9SV01
WP_010073369.1.47838 gi|302876107|ref|YP_003844740.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]