SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302875736|ref|YP_003844369.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875736|ref|YP_003844369.1|
Domain Number 1 Region: 5-64
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.0000000000741
Family SinR domain-like 0.066
Further Details:      
 
Domain Number 2 Region: 347-418
Classification Level Classification E-value
Superfamily TPR-like 0.00000000673
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 3 Region: 95-296
Classification Level Classification E-value
Superfamily TPR-like 0.000000759
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302875736|ref|YP_003844369.1|
Sequence length 419
Comment helix-turn-helix domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MEILSVGKKIKRARIYKGYTLKELCGDKLSVSKLSCIENDKIQAEEEVLLYIAKRLGLDY
DYLVQDIEKQITENIQECKKNADGYKYIEELNYNLEVAIECGYNDLAFEIIHSIFSWFID
KKNSKECHKYLTRYYELGTKIRGMRYLMFMDIGDFIYLNDEYVQALGYYETTLRYIEDNK
IEDKDVYYSAMFKKANCLIFLNRLEEAFELISEMENGVDFVSDSYLRARALGILGIVKYK
QTKNIEETYPFILQGIEIAEKEPEKFATIVYCYMNLFHKVGCNELALIYCNKILEIEAQL
NQEQKISYIIFVLEVFMKNEMYDDILNICNSHIDQVIAADNNIFTEKMYYFKAKALEKSG
EYRSAEIYYSLSLDILLKTGSKHEICQRYFEIGNMYYEMKNTVDAIKYLNFSMNIKEEL
Download sequence
Identical sequences D9SSU3
WP_010075698.1.47838 gi|302875736|ref|YP_003844369.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]