SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302875737|ref|YP_003844370.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302875737|ref|YP_003844370.1|
Domain Number 1 Region: 199-353,392-427
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000678
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 2 Region: 71-219
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000488
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 
Domain Number 3 Region: 4-68
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000000104
Family SinR domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302875737|ref|YP_003844370.1|
Sequence length 434
Comment helix-turn-helix domain-containing protein [Clostridium cellulovorans 743B]
Sequence
MEILSLGEKIKRLRKEKGFTLKDLAGDRITPGQISLVESGKSNPSMDLLEYLANTLHCTV
EYLMESEETQAEKICIYYENIAESHIIEKQWGLAEENIEKSSYYAEKYKLEYRKAKIYYL
KGDIEAEKGNLQKAQEYFLISNGIFTKEKLFEEMVDTFLKLGDISYNLKAYHSAITYFQQ
AERIFTDNEVINDFLKGKIYHNLAKIHQIFDQTDKAINYTYLAKEKFKQLDNKRDYGNTL
LLLAKEYLKNENLEYAIRYSNKALKTLDEARNLEYMGDIENNLGKLFYEFENIQESFDHY
EKARELRNKYDKNKLIGTLINMCNNYVKLKDIENARKVLEEINENIEYISDLDMVQVYIL
NFRLFHMENNDVYAEKNLLIALNYAESKELYKEAAQLSFKIGNFYLDKGDEKMANQYLNK
GVELFRSLGILQDI
Download sequence
Identical sequences D9SSU4
gi|302875737|ref|YP_003844370.1| WP_010075699.1.47838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]