SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302877030|ref|YP_003845663.1| from Clostridium cellulovorans 743B

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302877030|ref|YP_003845663.1|
Domain Number 1 Region: 15-180
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.33e-31
Family N-acetyl transferase, NAT 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302877030|ref|YP_003845663.1|
Sequence length 186
Comment N-acetyltransferase GCN5 [Clostridium cellulovorans 743B]
Sequence
MAIIEAKKYELSLGEVTLESAKGEDAALLILFIKKADSETDFLLRESDEFNISYENEKKF
IDDKRKNENELFITAKIDGEVVGTLGFAGSSFRRGKHKGQFGIVVLREYWGYGIGSKMLN
LLIEWADNVGLVKIALEVDADNERAIKIYKKFGFEVEGILKYNKHMGQGVYKDSILMARI
NHGKFK
Download sequence
Identical sequences D9SNA7
WP_010074252.1.47838 gi|302877030|ref|YP_003845663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]