SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|298503442|ref|YP_003725382.1| from Streptococcus pneumoniae TCH8431/19A

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|298503442|ref|YP_003725382.1|
Domain Number 1 Region: 13-243
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.2e-64
Family Alanine racemase-like, N-terminal domain 0.0000133
Further Details:      
 
Domain Number 2 Region: 237-367
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 3.66e-47
Family Alanine racemase 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|298503442|ref|YP_003725382.1|
Sequence length 367
Comment alanine racemase [Streptococcus pneumoniae TCH8431/19A]
Sequence
MKASPHRPTKALIHLGAIRQNIQQMGAHIPQGTLKLAVVKANAYGHGAVAVAKAIQDDVD
GFCVSNIDEAIELRQAGLSKPILILGVSEIEAVALAKEYDFTLTVAGLEWIQALLDKEVD
LTGLTVHLKIDSGMGRIGFREASEVEQAQDLLQQHGVCVEGIFTHFATADEESDDYFNAQ
LERFKTILASMKEVPELVHASNSATTLWHVETIFNAVRMGDAMYGLNPSGAVLDLPYDLI
PALTLESALVHVKTVPAGACMGYGATYQADSEQVIATVPIGYADGWTRDMQNFSVLVDGQ
ACPIVGRVSMDQITIRLPKLYPLGTKVTLIGSNGDKEITATQVATYRVTINYEVVCLLSD
RIPREYY
Download sequence
Identical sequences A0A0E8PBE8 B8ZMG1 C1CFR7 C1CM34 D6ZMQ4 M5MX51 P0A2W8 P0A2W9 Q04J74
gi|480532693|ref|YP_007764896.1| gi|225855126|ref|YP_002736638.1| gi|15901532|ref|NP_346136.1| 170187.SP_1698 373153.SPD_1508 488222.SPJ_1591 488223.SPP_1714 561276.SPN23F_16970 gi|221232432|ref|YP_002511585.1| 3s46_A 3s46_B WP_000648075.1.100397 WP_000648075.1.100885 WP_000648075.1.100911 WP_000648075.1.100947 WP_000648075.1.101127 WP_000648075.1.101241 WP_000648075.1.101394 WP_000648075.1.101407 WP_000648075.1.101500 WP_000648075.1.10153 WP_000648075.1.101577 WP_000648075.1.10169 WP_000648075.1.101763 WP_000648075.1.101806 WP_000648075.1.102091 WP_000648075.1.10261 WP_000648075.1.10295 WP_000648075.1.10337 WP_000648075.1.10458 WP_000648075.1.10713 WP_000648075.1.10731 WP_000648075.1.1083 WP_000648075.1.10900 WP_000648075.1.11279 WP_000648075.1.1131 WP_000648075.1.11328 WP_000648075.1.11428 WP_000648075.1.11537 WP_000648075.1.11922 WP_000648075.1.11967 WP_000648075.1.12134 WP_000648075.1.12218 WP_000648075.1.12336 WP_000648075.1.12395 WP_000648075.1.124 WP_000648075.1.12413 WP_000648075.1.12435 WP_000648075.1.12470 WP_000648075.1.12543 WP_000648075.1.12723 WP_000648075.1.12777 WP_000648075.1.128 WP_000648075.1.12966 WP_000648075.1.1302 WP_000648075.1.13100 WP_000648075.1.13256 WP_000648075.1.1332 WP_000648075.1.13402 WP_000648075.1.13607 WP_000648075.1.1368 WP_000648075.1.13705 WP_000648075.1.13729 WP_000648075.1.14218 WP_000648075.1.14260 WP_000648075.1.14287 WP_000648075.1.14295 WP_000648075.1.14347 WP_000648075.1.14784 WP_000648075.1.14949 WP_000648075.1.14957 WP_000648075.1.14959 WP_000648075.1.15305 WP_000648075.1.15391 WP_000648075.1.15440 WP_000648075.1.15578 WP_000648075.1.15607 WP_000648075.1.15650 WP_000648075.1.15759 WP_000648075.1.15787 WP_000648075.1.15849 WP_000648075.1.15854 WP_000648075.1.1590 WP_000648075.1.16240 WP_000648075.1.16316 WP_000648075.1.16323 WP_000648075.1.16404 WP_000648075.1.16479 WP_000648075.1.1672 WP_000648075.1.16730 WP_000648075.1.16904 WP_000648075.1.17063 WP_000648075.1.17227 WP_000648075.1.17254 WP_000648075.1.17672 WP_000648075.1.17677 WP_000648075.1.17688 WP_000648075.1.17690 WP_000648075.1.17706 WP_000648075.1.1783 WP_000648075.1.17972 WP_000648075.1.18127 WP_000648075.1.1846 WP_000648075.1.18488 WP_000648075.1.18496 WP_000648075.1.18764 WP_000648075.1.18948 WP_000648075.1.19015 WP_000648075.1.19045 WP_000648075.1.19420 WP_000648075.1.19489 WP_000648075.1.19633 WP_000648075.1.19721 WP_000648075.1.20015 WP_000648075.1.20041 WP_000648075.1.20079 WP_000648075.1.20207 WP_000648075.1.2030 WP_000648075.1.2060 WP_000648075.1.20603 WP_000648075.1.20701 WP_000648075.1.20782 WP_000648075.1.20966 WP_000648075.1.20984 WP_000648075.1.21211 WP_000648075.1.21278 WP_000648075.1.21355 WP_000648075.1.21370 WP_000648075.1.21377 WP_000648075.1.21436 WP_000648075.1.21507 WP_000648075.1.21551 WP_000648075.1.21605 WP_000648075.1.21788 WP_000648075.1.2180 WP_000648075.1.21990 WP_000648075.1.21998 WP_000648075.1.22016 WP_000648075.1.22035 WP_000648075.1.22196 WP_000648075.1.22397 WP_000648075.1.22506 WP_000648075.1.2257 WP_000648075.1.22591 WP_000648075.1.22616 WP_000648075.1.22636 WP_000648075.1.22675 WP_000648075.1.22723 WP_000648075.1.22904 WP_000648075.1.22914 WP_000648075.1.22938 WP_000648075.1.23477 WP_000648075.1.23659 WP_000648075.1.24098 WP_000648075.1.24102 WP_000648075.1.24262 WP_000648075.1.24471 WP_000648075.1.24571 WP_000648075.1.24598 WP_000648075.1.24627 WP_000648075.1.24724 WP_000648075.1.25366 WP_000648075.1.25383 WP_000648075.1.25483 WP_000648075.1.25553 WP_000648075.1.25686 WP_000648075.1.2573 WP_000648075.1.25742 WP_000648075.1.25754 WP_000648075.1.25791 WP_000648075.1.25818 WP_000648075.1.26059 WP_000648075.1.2607 WP_000648075.1.2610 WP_000648075.1.26725 WP_000648075.1.26807 WP_000648075.1.26877 WP_000648075.1.26926 WP_000648075.1.27151 WP_000648075.1.27210 WP_000648075.1.27324 WP_000648075.1.27418 WP_000648075.1.27421 WP_000648075.1.27589 WP_000648075.1.27714 WP_000648075.1.27721 WP_000648075.1.27789 WP_000648075.1.27808 WP_000648075.1.27853 WP_000648075.1.27886 WP_000648075.1.28068 WP_000648075.1.28350 WP_000648075.1.28708 WP_000648075.1.28727 WP_000648075.1.28746 WP_000648075.1.28772 WP_000648075.1.28816 WP_000648075.1.28867 WP_000648075.1.28868 WP_000648075.1.28931 WP_000648075.1.2900 WP_000648075.1.29205 WP_000648075.1.29269 WP_000648075.1.29323 WP_000648075.1.29469 WP_000648075.1.29653 WP_000648075.1.2966 WP_000648075.1.29694 WP_000648075.1.29734 WP_000648075.1.29951 WP_000648075.1.30038 WP_000648075.1.30167 WP_000648075.1.30243 WP_000648075.1.30287 WP_000648075.1.30757 WP_000648075.1.30891 WP_000648075.1.30917 WP_000648075.1.30942 WP_000648075.1.3105 WP_000648075.1.31099 WP_000648075.1.31550 WP_000648075.1.31586 WP_000648075.1.3191 WP_000648075.1.31979 WP_000648075.1.31996 WP_000648075.1.3211 WP_000648075.1.32128 WP_000648075.1.32313 WP_000648075.1.32397 WP_000648075.1.3255 WP_000648075.1.32644 WP_000648075.1.32701 WP_000648075.1.32719 WP_000648075.1.32771 WP_000648075.1.32774 WP_000648075.1.32792 WP_000648075.1.32820 WP_000648075.1.32892 WP_000648075.1.33070 WP_000648075.1.33091 WP_000648075.1.33180 WP_000648075.1.33437 WP_000648075.1.33458 WP_000648075.1.33528 WP_000648075.1.33634 WP_000648075.1.33637 WP_000648075.1.33719 WP_000648075.1.3375 WP_000648075.1.33891 WP_000648075.1.33897 WP_000648075.1.33956 WP_000648075.1.34097 WP_000648075.1.34120 WP_000648075.1.34466 WP_000648075.1.34522 WP_000648075.1.34559 WP_000648075.1.34699 WP_000648075.1.34792 WP_000648075.1.34809 WP_000648075.1.35098 WP_000648075.1.35218 WP_000648075.1.3530 WP_000648075.1.35678 WP_000648075.1.35919 WP_000648075.1.36242 WP_000648075.1.36317 WP_000648075.1.36471 WP_000648075.1.36492 WP_000648075.1.36803 WP_000648075.1.36982 WP_000648075.1.37164 WP_000648075.1.37166 WP_000648075.1.37194 WP_000648075.1.37324 WP_000648075.1.37541 WP_000648075.1.37640 WP_000648075.1.38238 WP_000648075.1.38573 WP_000648075.1.38868 WP_000648075.1.38887 WP_000648075.1.38892 WP_000648075.1.39006 WP_000648075.1.39071 WP_000648075.1.39121 WP_000648075.1.3917 WP_000648075.1.39318 WP_000648075.1.39453 WP_000648075.1.395 WP_000648075.1.39585 WP_000648075.1.39648 WP_000648075.1.39710 WP_000648075.1.40347 WP_000648075.1.40558 WP_000648075.1.40566 WP_000648075.1.40568 WP_000648075.1.40682 WP_000648075.1.40696 WP_000648075.1.41275 WP_000648075.1.4159 WP_000648075.1.41673 WP_000648075.1.41787 WP_000648075.1.41937 WP_000648075.1.41952 WP_000648075.1.41958 WP_000648075.1.42076 WP_000648075.1.42140 WP_000648075.1.42331 WP_000648075.1.42358 WP_000648075.1.42625 WP_000648075.1.42642 WP_000648075.1.42935 WP_000648075.1.42964 WP_000648075.1.43051 WP_000648075.1.43464 WP_000648075.1.43467 WP_000648075.1.43558 WP_000648075.1.4366 WP_000648075.1.43714 WP_000648075.1.43900 WP_000648075.1.43934 WP_000648075.1.44003 WP_000648075.1.44024 WP_000648075.1.44439 WP_000648075.1.44872 WP_000648075.1.45006 WP_000648075.1.4512 WP_000648075.1.45287 WP_000648075.1.45476 WP_000648075.1.45691 WP_000648075.1.45843 WP_000648075.1.45948 WP_000648075.1.46024 WP_000648075.1.46060 WP_000648075.1.46088 WP_000648075.1.4621 WP_000648075.1.46295 WP_000648075.1.46498 WP_000648075.1.46564 WP_000648075.1.47043 WP_000648075.1.47045 WP_000648075.1.47176 WP_000648075.1.47288 WP_000648075.1.47365 WP_000648075.1.47444 WP_000648075.1.47452 WP_000648075.1.47595 WP_000648075.1.48043 WP_000648075.1.48089 WP_000648075.1.48181 WP_000648075.1.48533 WP_000648075.1.48614 WP_000648075.1.48698 WP_000648075.1.48731 WP_000648075.1.48828 WP_000648075.1.48890 WP_000648075.1.4894 WP_000648075.1.49134 WP_000648075.1.49216 WP_000648075.1.49385 WP_000648075.1.49407 WP_000648075.1.49587 WP_000648075.1.50089 WP_000648075.1.5022 WP_000648075.1.50621 WP_000648075.1.5065 WP_000648075.1.50757 WP_000648075.1.50824 WP_000648075.1.50915 WP_000648075.1.51249 WP_000648075.1.51361 WP_000648075.1.51417 WP_000648075.1.51470 WP_000648075.1.51546 WP_000648075.1.51579 WP_000648075.1.51658 WP_000648075.1.51684 WP_000648075.1.52004 WP_000648075.1.52049 WP_000648075.1.52055 WP_000648075.1.52263 WP_000648075.1.52276 WP_000648075.1.52329 WP_000648075.1.52384 WP_000648075.1.52386 WP_000648075.1.52570 WP_000648075.1.52834 WP_000648075.1.52957 WP_000648075.1.53010 WP_000648075.1.53108 WP_000648075.1.53112 WP_000648075.1.53355 WP_000648075.1.53380 WP_000648075.1.53395 WP_000648075.1.53405 WP_000648075.1.5348 WP_000648075.1.53581 WP_000648075.1.5385 WP_000648075.1.54337 WP_000648075.1.5435 WP_000648075.1.54424 WP_000648075.1.54458 WP_000648075.1.54563 WP_000648075.1.54576 WP_000648075.1.54738 WP_000648075.1.54997 WP_000648075.1.55143 WP_000648075.1.55211 WP_000648075.1.55329 WP_000648075.1.55479 WP_000648075.1.55523 WP_000648075.1.55589 WP_000648075.1.55763 WP_000648075.1.55980 WP_000648075.1.56054 WP_000648075.1.56257 WP_000648075.1.56462 WP_000648075.1.56477 WP_000648075.1.57089 WP_000648075.1.57382 WP_000648075.1.57394 WP_000648075.1.57587 WP_000648075.1.57611 WP_000648075.1.57615 WP_000648075.1.57753 WP_000648075.1.57787 WP_000648075.1.57922 WP_000648075.1.58034 WP_000648075.1.58036 WP_000648075.1.58402 WP_000648075.1.58717 WP_000648075.1.58854 WP_000648075.1.58905 WP_000648075.1.59198 WP_000648075.1.59676 WP_000648075.1.59883 WP_000648075.1.59913 WP_000648075.1.59918 WP_000648075.1.6001 WP_000648075.1.60242 WP_000648075.1.60513 WP_000648075.1.60529 WP_000648075.1.60714 WP_000648075.1.60737 WP_000648075.1.60749 WP_000648075.1.60755 WP_000648075.1.60961 WP_000648075.1.60996 WP_000648075.1.61151 WP_000648075.1.61208 WP_000648075.1.61220 WP_000648075.1.61307 WP_000648075.1.61372 WP_000648075.1.61471 WP_000648075.1.61506 WP_000648075.1.61686 WP_000648075.1.61731 WP_000648075.1.61845 WP_000648075.1.61959 WP_000648075.1.62114 WP_000648075.1.62178 WP_000648075.1.62190 WP_000648075.1.62356 WP_000648075.1.62366 WP_000648075.1.62390 WP_000648075.1.62445 WP_000648075.1.62518 WP_000648075.1.62524 WP_000648075.1.62862 WP_000648075.1.62921 WP_000648075.1.63442 WP_000648075.1.63468 WP_000648075.1.63621 WP_000648075.1.63936 WP_000648075.1.64006 WP_000648075.1.64055 WP_000648075.1.6414 WP_000648075.1.64267 WP_000648075.1.64373 WP_000648075.1.64416 WP_000648075.1.64719 WP_000648075.1.64839 WP_000648075.1.64890 WP_000648075.1.6505 WP_000648075.1.65126 WP_000648075.1.65352 WP_000648075.1.65568 WP_000648075.1.65607 WP_000648075.1.65722 WP_000648075.1.6577 WP_000648075.1.65792 WP_000648075.1.65971 WP_000648075.1.66046 WP_000648075.1.6621 WP_000648075.1.66399 WP_000648075.1.66640 WP_000648075.1.66653 WP_000648075.1.66683 WP_000648075.1.6679 WP_000648075.1.66861 WP_000648075.1.67051 WP_000648075.1.67389 WP_000648075.1.67515 WP_000648075.1.67655 WP_000648075.1.67930 WP_000648075.1.68077 WP_000648075.1.68078 WP_000648075.1.6812 WP_000648075.1.68238 WP_000648075.1.68464 WP_000648075.1.68578 WP_000648075.1.68660 WP_000648075.1.68807 WP_000648075.1.68835 WP_000648075.1.6890 WP_000648075.1.69017 WP_000648075.1.69137 WP_000648075.1.69344 WP_000648075.1.69416 WP_000648075.1.69428 WP_000648075.1.69486 WP_000648075.1.69560 WP_000648075.1.69671 WP_000648075.1.69752 WP_000648075.1.70110 WP_000648075.1.70221 WP_000648075.1.70557 WP_000648075.1.70617 WP_000648075.1.71206 WP_000648075.1.7126 WP_000648075.1.71360 WP_000648075.1.71697 WP_000648075.1.71818 WP_000648075.1.71977 WP_000648075.1.72071 WP_000648075.1.72082 WP_000648075.1.72095 WP_000648075.1.72108 WP_000648075.1.72472 WP_000648075.1.72502 WP_000648075.1.72542 WP_000648075.1.72628 WP_000648075.1.7268 WP_000648075.1.72854 WP_000648075.1.72911 WP_000648075.1.732 WP_000648075.1.73214 WP_000648075.1.73359 WP_000648075.1.73397 WP_000648075.1.73462 WP_000648075.1.73476 WP_000648075.1.73500 WP_000648075.1.73502 WP_000648075.1.73543 WP_000648075.1.7359 WP_000648075.1.73593 WP_000648075.1.73675 WP_000648075.1.73939 WP_000648075.1.74009 WP_000648075.1.74033 WP_000648075.1.7420 WP_000648075.1.74260 WP_000648075.1.74608 WP_000648075.1.7468 WP_000648075.1.75317 WP_000648075.1.75370 WP_000648075.1.75406 WP_000648075.1.75701 WP_000648075.1.75907 WP_000648075.1.75987 WP_000648075.1.76018 WP_000648075.1.76093 WP_000648075.1.76251 WP_000648075.1.76264 WP_000648075.1.76454 WP_000648075.1.76614 WP_000648075.1.76692 WP_000648075.1.7673 WP_000648075.1.76837 WP_000648075.1.76942 WP_000648075.1.77223 WP_000648075.1.77664 WP_000648075.1.78379 WP_000648075.1.78397 WP_000648075.1.78455 WP_000648075.1.78535 WP_000648075.1.78755 WP_000648075.1.78794 WP_000648075.1.78796 WP_000648075.1.78865 WP_000648075.1.78866 WP_000648075.1.7924 WP_000648075.1.79329 WP_000648075.1.79451 WP_000648075.1.79958 WP_000648075.1.80148 WP_000648075.1.80228 WP_000648075.1.80279 WP_000648075.1.80367 WP_000648075.1.8041 WP_000648075.1.80597 WP_000648075.1.80611 WP_000648075.1.80914 WP_000648075.1.81033 WP_000648075.1.81296 WP_000648075.1.81395 WP_000648075.1.81473 WP_000648075.1.815 WP_000648075.1.81534 WP_000648075.1.81586 WP_000648075.1.81817 WP_000648075.1.82051 WP_000648075.1.82191 WP_000648075.1.82603 WP_000648075.1.82818 WP_000648075.1.82869 WP_000648075.1.83158 WP_000648075.1.83244 WP_000648075.1.83311 WP_000648075.1.83439 WP_000648075.1.83574 WP_000648075.1.83796 WP_000648075.1.83863 WP_000648075.1.8392 WP_000648075.1.83974 WP_000648075.1.8398 WP_000648075.1.84061 WP_000648075.1.84500 WP_000648075.1.84643 WP_000648075.1.84897 WP_000648075.1.84931 WP_000648075.1.84991 WP_000648075.1.85062 WP_000648075.1.85123 WP_000648075.1.85212 WP_000648075.1.85373 WP_000648075.1.85434 WP_000648075.1.85470 WP_000648075.1.85508 WP_000648075.1.85588 WP_000648075.1.85629 WP_000648075.1.85659 WP_000648075.1.85661 WP_000648075.1.85718 WP_000648075.1.8574 WP_000648075.1.85880 WP_000648075.1.86020 WP_000648075.1.86061 WP_000648075.1.86211 WP_000648075.1.86297 WP_000648075.1.86300 WP_000648075.1.86320 WP_000648075.1.8655 WP_000648075.1.86655 WP_000648075.1.86689 WP_000648075.1.86812 WP_000648075.1.86866 WP_000648075.1.8708 WP_000648075.1.87138 WP_000648075.1.87332 WP_000648075.1.8734 WP_000648075.1.87422 WP_000648075.1.87839 WP_000648075.1.87904 WP_000648075.1.87922 WP_000648075.1.88811 WP_000648075.1.88932 WP_000648075.1.89032 WP_000648075.1.89094 WP_000648075.1.8926 WP_000648075.1.89525 WP_000648075.1.8963 WP_000648075.1.89640 WP_000648075.1.89645 WP_000648075.1.89652 WP_000648075.1.89763 WP_000648075.1.89905 WP_000648075.1.90197 WP_000648075.1.90319 WP_000648075.1.90502 WP_000648075.1.90529 WP_000648075.1.90603 WP_000648075.1.90606 WP_000648075.1.90676 WP_000648075.1.90778 WP_000648075.1.90957 WP_000648075.1.90989 WP_000648075.1.91015 WP_000648075.1.91358 WP_000648075.1.91369 WP_000648075.1.91775 WP_000648075.1.92344 WP_000648075.1.92369 WP_000648075.1.92814 WP_000648075.1.92971 WP_000648075.1.93152 WP_000648075.1.93154 WP_000648075.1.93178 WP_000648075.1.93210 WP_000648075.1.93281 WP_000648075.1.93398 WP_000648075.1.93515 WP_000648075.1.93773 WP_000648075.1.93878 WP_000648075.1.94391 WP_000648075.1.94442 WP_000648075.1.94469 WP_000648075.1.94515 WP_000648075.1.94558 WP_000648075.1.95041 WP_000648075.1.95104 WP_000648075.1.95128 WP_000648075.1.95258 WP_000648075.1.95312 WP_000648075.1.95765 WP_000648075.1.95856 WP_000648075.1.95868 WP_000648075.1.95876 WP_000648075.1.95879 WP_000648075.1.95968 WP_000648075.1.96309 WP_000648075.1.96350 WP_000648075.1.96833 WP_000648075.1.96872 WP_000648075.1.96939 WP_000648075.1.96974 WP_000648075.1.97091 WP_000648075.1.97158 WP_000648075.1.97252 WP_000648075.1.97381 WP_000648075.1.97556 WP_000648075.1.97994 WP_000648075.1.98245 WP_000648075.1.98277 WP_000648075.1.98319 WP_000648075.1.98376 WP_000648075.1.98427 WP_000648075.1.98989 WP_000648075.1.99066 WP_000648075.1.99126 WP_000648075.1.99203 WP_000648075.1.99628 WP_000648075.1.99687 WP_000648075.1.99900 gi|298503442|ref|YP_003725382.1| NYSGRC-FDAO-AAK75776 gi|116515765|ref|YP_816964.1| gi|225857311|ref|YP_002738822.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]