SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297544198|ref|YP_003676500.1| from Thermoanaerobacter mathranii subsp. mathranii str. A3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297544198|ref|YP_003676500.1|
Domain Number 1 Region: 8-132
Classification Level Classification E-value
Superfamily AF1862-like 4.58e-35
Family Cas Cmr5-like 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297544198|ref|YP_003676500.1|
Sequence length 135
Comment Cmr5 family CRISPR-associated protein [Thermoanaerobacter mathranii subsp. mathranii str. A3]
Sequence
MTDKDSIKTTVNERAKFAYECVKKVATYEKEEFKNNYKSYAKKLMAIIKTNGLGATLAFM
KAKGSSVYQELYNNIDSWLKSENCPVSSLYSNSTADMVEKIISLESDAYRAITKEVMEFI
NWIRKFAEGMIPDDK
Download sequence
Identical sequences D7ATY2
gi|297544198|ref|YP_003676500.1| WP_013150029.1.86608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]