SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297545312|ref|YP_003677614.1| from Thermoanaerobacter mathranii subsp. mathranii str. A3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297545312|ref|YP_003677614.1|
Domain Number 1 Region: 81-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.29e-27
Family Translational machinery components 0.00017
Further Details:      
 
Domain Number 2 Region: 6-77
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.03e-21
Family Ribosomal S5 protein, N-terminal domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297545312|ref|YP_003677614.1|
Sequence length 167
Comment 30S ribosomal protein S5 [Thermoanaerobacter mathranii subsp. mathranii str. A3]
Sequence
MARVDWTKLDLKERVVSINRVAKVVKGGRNFRFSVTVVVGDAEKGYVGVGRGKAAEIPDA
IRKAIEDAKKHLIKVPIVGTTIPHEVIGEFGAGKVLLKPAKEGTGVIAGGPVRAVLESAG
IKDVLTKSLGSSNATNMVYATMEGLKRLRTAEDVARLRGIPVSQLFE
Download sequence
Identical sequences D3T4N8 D7ARR1
WP_012995895.1.100455 WP_012995895.1.28907 WP_012995895.1.7020 WP_012995895.1.86608 gi|297545312|ref|YP_003677614.1| gi|289579125|ref|YP_003477752.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]