SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302866529|ref|YP_003835166.1| from Micromonospora aurantiaca ATCC 27029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302866529|ref|YP_003835166.1|
Domain Number 1 Region: 72-587
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 2.62e-203
Family Heme-dependent catalases 0.000000000073
Further Details:      
 
Domain Number 2 Region: 596-748
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 0.00000000583
Family Catalase, C-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302866529|ref|YP_003835166.1|
Sequence length 753
Comment catalase [Micromonospora aurantiaca ATCC 27029]
Sequence
MESSKPTQIVKGVVEAAVEKVGDALTPDVPGAPGSAPPPLEEPTTPHGPLPPKDEQGAPD
TRTPTGAETGVPKIAKGQQGAYLTTANGARLRDTDHSLKAGPRGPVLLQDHHLREKITHF
DHERIPERVVHARGAGAHGTFVAYGTAEEVTRAGFLKKGRETPVFVRFSTVLGSRGSADT
VRDTRGFATKFYTDEGTFDLVANNIPVFFIQDAIKFPDVIHAGKPHPDREIPQAQSAHDT
FWDFVSLHTEAQHHTIWNMSDRGIPRSYRTMEGFGVHTFRMVDEAGATVLVKFHWKPKLG
VHSLTWEEAQLIGGIDPDYHRRDLYDAIEAGAYPEWELGIQVFPDTPEETFAGIDLLDPT
KIVPEELAPVQPIGKLTLNKTPRNFFAETEQVAFHVGHLPPGIDVTNDPLLQGRLFSYVD
TQLTRLGGPNFTQIPINRPHADVNDMLRDGFHQHAVHAGVAPYRPNSLDGGNPFPAGDRE
HAFVDTPVTVAEAPKVRAAPASFDDHYSQVRLFWQSMSPVEKEHIIRAYTFELGKCYHQA
IKERQLQCLANVDPVLCEQVAIGLGLPVPQPTVPPAEVQPSPALSQVGREWPADGRMVGI
VVDAQADLGDVHEVRREVFAAGMVPLLIAAHGGTVDGLPVQRTFATGRSVELDAVLLAGA
PAPAPDALPARDAKAGAPGSPTVDPRVLLLVEEAWRHAKVIGAWGAGAEVLHQAGVTGTP
GVVTGGSGTEVLGEVQRLMAAHRVWERFPASVA
Download sequence
Identical sequences D9T362
gi|302866529|ref|YP_003835166.1| WP_013285222.1.64435 WP_013285222.1.81987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]