SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302865764|ref|YP_003834401.1| from Micromonospora aurantiaca ATCC 27029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302865764|ref|YP_003834401.1|
Domain Number 1 Region: 11-226,259-337
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 5.49e-53
Family ADP-ribosylglycohydrolase 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302865764|ref|YP_003834401.1|
Sequence length 355
Comment ADP-ribosylation/Crystallin J1 [Micromonospora aurantiaca ATCC 27029]
Sequence
MIATVTASTATGRAAGSLFGLAYGDALGKPTEFLTVTEIVRRYGPGGPRELTGDPALVTD
DTQMALAVAWALHDAPAYTAEVVEPLLRQRFVDWSVSPENNRAPGMTCLRACAELARGSR
WQEATVAGSKGCGANMRVTPVGLLDVDLDTMAGLAQLQAGLTHGHPTGLAASELTAYAVR
LLRDGAALPELPGLLTERAREQRTVYREDWLGDLWQRPGESSAAEFVAQGWDDCLRVLGR
LEAALARPDDGGDPCRFTGEGWIAEEALATALLCALRHTDDPVGALARGATTAGDSDSIA
ALAGAFVGAAYGTAAWPAGWAGRIEYAGQLTALADAFDGEAPGAGSPRDGRGPAA
Download sequence
Identical sequences D9TE96
WP_013284464.1.81987 gi|302865764|ref|YP_003834401.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]