SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302866731|ref|YP_003835368.1| from Micromonospora aurantiaca ATCC 27029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302866731|ref|YP_003835368.1|
Domain Number 1 Region: 14-297
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 3.92e-48
Family ADP-ribosylglycohydrolase 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302866731|ref|YP_003835368.1|
Sequence length 309
Comment ADP-ribosylation/Crystallin J1 [Micromonospora aurantiaca ATCC 27029]
Sequence
MTFTLFPDTRLTLARDALAGLSVGDALGSQFFVPGRHPDDLAAGRLPAPPWEWTDDTEMA
CSVVAELAADGRIDRDRLALAFAQRCEPYRGYGPGAVTVLRLIRTGTPWPVAAASAFDGQ
GSCGNGAAMRVAPLGAWHADSTRRAAEQARASAEVTHAHPEGVAGAVAVAVAAALAARAR
LDGGRPDPARLLTAVAGALDPAGEVHRGVRRAAALLGHSAAEAADALGNGSRVTAQDTVP
FTLWVAATLLHDYPAAIRACVEAGGDVDTTAAIVGGIVAAYTGVGAPGGVPEGWLTAREP
LPTWLPTPA
Download sequence
Identical sequences D9T4T1
gi|302866731|ref|YP_003835368.1| WP_013285423.1.64435 WP_013285423.1.81987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]