SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302870684|ref|YP_003839321.1| from Micromonospora aurantiaca ATCC 27029

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302870684|ref|YP_003839321.1|
Domain Number 1 Region: 23-152
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 2.62e-39
Family Molybdopterin synthase subunit MoaE 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302870684|ref|YP_003839321.1|
Sequence length 154
Comment molybdopterin biosynthesis MoaE protein [Micromonospora aurantiaca ATCC 27029]
Sequence
MSATNEPTGDVVTVEAGVVLGAVTDRPLDLAAHEAAVADRRAGAVVSFQGVVRDHDHGRA
VTRLEYEGHPTAEAVLREVAAEVAADPQVYAVAVSHRIGPLEIGDVALVAAVSTAHRAAA
FAACARLVDEVKARLPIWKRQVFDDGSEEWVNCP
Download sequence
Identical sequences D9T3Z7
gi|302870684|ref|YP_003839321.1| WP_013289342.1.81987

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]