SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385858972|ref|YP_005905482.1| from Mycoplasma haemofelis Ohio2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385858972|ref|YP_005905482.1|
Domain Number 1 Region: 166-689
Classification Level Classification E-value
Superfamily PFL-like glycyl radical enzymes 2.81e-169
Family R1 subunit of ribonucleotide reductase, C-terminal domain 0.00000000118
Further Details:      
 
Domain Number 2 Region: 9-164
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 4.58e-33
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385858972|ref|YP_005905482.1|
Sequence length 700
Comment Ribonucleoside-diphosphate reductase, alpha subunit [Mycoplasma haemofelis Ohio2]
Sequence
MSDHLKRSLELNNMVTYKSPDGFFDVSKDLEAIAEYEKYVDENFATDLEGIERIRWLIEN
NFYVADLINSFTDAEVIEIIDLVKSYNFRFKSYMSIKKFYDSYALRTDDKKRFLERYDDR
IIACALFLGRRDFNFAKKLAKSMIEQKYQPATPTFSNAGKKRSGELVSCFLLEVDDSLNS
INYIISTAMQLSKIGGGVAINLSKLRARGAQIKHIEAAASGVIPVIKILENVFDYADQLG
QRPGAGAAYLSIFHWDLIEFLDCKKINADEKSRIQTLSLGLLVPNKFIDLCIEGADYYLF
EPYTVFKKYGVHMSDMDMSKWYEVLAHDPDILKKSISARDVLNNIAKTQFESGYPYIIYI
DTANKKNPLKKLGQIKMSNLCTEIFQIQETSTIKDYGDLDDIRYDVSCNLGSLNINSLFE
GEKNLEETIEVAMRALSMVSDISSIANAPGVRKANSELHSVGLGAMNLAGFLAKNKLHYD
SPEAVEFASVLFAAINFFSIKASCLIAQERKKTFEGFEKSDYYSGVYFLKYLENDYLPKS
DVVKELFKDMKLPTREDWQELAKKVKECGLYNAYRLAIAPTQTISYLNNSTPSIAPVVDV
LETRLYGNSLTYYPMPFLNKDTWYYYKSAYLLDQKAIIDMVSAIQEHVDQGISTVLYVTN
NTSTRDLVRFYIYAWHKGLKSLYYTRTKNLEIEECLSCAA
Download sequence
Identical sequences E8ZKC2 F6FFK6
gi|385858972|ref|YP_005905482.1| gi|321309598|ref|YP_004191927.1| WP_014582868.1.29895 WP_014582868.1.43505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]