SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302347818|ref|YP_003815456.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302347818|ref|YP_003815456.1|
Domain Number - Region: 76-111
Classification Level Classification E-value
Superfamily Flavoproteins 0.0393
Family Flavodoxin-related 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302347818|ref|YP_003815456.1|
Sequence length 253
Comment CRISPR-associated protein, APE2256 family [Acidilobus saccharovorans 345-15]
Sequence
MRYASRSAGLSREQAELLERCSRLDVDAEDECERLAGAGRSDPLLDRLRSYLSSSPYEAS
AELNSLQPFLEAGMVQRVVLYYYSDSGAAHLVALLLTEYLKRAGVAAEAVPAGEGERNLA
AGLLNIMREVGSRALRDQGEGYTIMLNITPGFKAEAAYFTLGLMLRNITALAYYRHEAMK
STVGVPLLHTTALRDAVTSLRAKVGARLEDLDANELVTVIAARLNSGRLSLGPVVKDDLV
WAEELLAASGITS
Download sequence
Identical sequences D9PZD7
gi|302347818|ref|YP_003815456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]