SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302347918|ref|YP_003815556.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302347918|ref|YP_003815556.1|
Domain Number 1 Region: 17-258
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 2.36e-68
Family Purine and uridine phosphorylases 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302347918|ref|YP_003815556.1|
Sequence length 281
Comment Uridine phosphorylase [Acidilobus saccharovorans 345-15]
Sequence
MEERMSSASRPFDSEGRAYHLGLRKGDVPKYVLMPGEVERASRIASSWDRSWRLAQRREY
SSFRGVYRGVDVAVVSTGIGGPATAIAVEELLELGADTLIRVGSTGAIQDDIEVGDIIIT
TAAVRMDGTSYQYAPAGYPASASYEVIMALVEAAESLGVRYHLGITASTDSFYVGQGRPG
YGGYMPSWSRNLVPDLRQMRVLNFEMESATLLTLANIYGFRAGAVHAVYAQRVKDEFVAH
AGEENLIKVADEAVRILHEWDEVKGRAGKRYFYPSLLRPGP
Download sequence
Identical sequences D9PZN7
gi|302347918|ref|YP_003815556.1| WP_013266037.1.78912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]