SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302347943|ref|YP_003815581.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302347943|ref|YP_003815581.1|
Domain Number 1 Region: 235-355
Classification Level Classification E-value
Superfamily YutG-like 1.83e-17
Family YutG-like 0.0045
Further Details:      
 
Weak hits

Sequence:  gi|302347943|ref|YP_003815581.1|
Domain Number - Region: 120-218
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.0732
Family ATP-dependent DNA ligase DNA-binding domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302347943|ref|YP_003815581.1|
Sequence length 360
Comment adenosylcobinamide amidohydrolase, [Acidilobus saccharovorans 345-15]
Sequence
MAALELGDRYLIVNFGAPRHILTTAHPEGLVMASKVAIYQVTDSDDLSRPERFKEEVRRA
LGLGGSDPVMLTAADVSKYRSAVEGNYGVVATVGLSHPSCHDMRSTYVPLMPSTINIVAW
VPDRLTASAMVDLLRVVAETKAAASADLMLRCDGGRATGTVSDAIAVAATLDPSGALWAG
QATTVGSKVASLVYRALVSEKPSREQVLSWALGLSLEELVDDAMKLYRSAPVPGVAEGKV
KEMVARELSRILQDPNVWAFIVAARENDIRGQEGLLPGLGSDEFAADTKKVIADELLATA
LSLYINGFKALTATYWADAMKDRLGLKLASLPMFEDDIAASLAASALSRVYDRLLGEGHD
Download sequence
Identical sequences D9PZR2
gi|302347943|ref|YP_003815581.1| WP_013266062.1.78912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]