SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302348079|ref|YP_003815717.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348079|ref|YP_003815717.1|
Domain Number 1 Region: 38-165
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 2.62e-39
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00042
Further Details:      
 
Domain Number 2 Region: 167-300
Classification Level Classification E-value
Superfamily Translational machinery components 6.98e-38
Family ERF1/Dom34 middle domain-like 0.001
Further Details:      
 
Domain Number 3 Region: 309-398
Classification Level Classification E-value
Superfamily L30e-like 2.24e-20
Family ERF1/Dom34 C-terminal domain-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302348079|ref|YP_003815717.1|
Sequence length 403
Comment peptide chain release factor subunit 1 [Acidilobus saccharovorans 345-15]
Sequence
MNNIKRNKVNNRKGLIGSALTLNRKGTMSEDLEKKLLVDKRTLKEVINELKQWSAPATVL
LSLYVPPGRPISDVTQMLREELSLADNIKLKRTRNAVKRAIAAAIDRLSMIPKVPPNGLV
AFCGENLDNGDFKCYVFSPPEKVPVFYYRTDKRFITEILEDMIENEDSVGVIIVERDHAT
IGLIKGSRIQVLEELEDFIPGKHMMGGQSQRRYDRIIEQMVDDFMKKVGERANEYLLPIY
EAGKLKAIIVAGPGYAKSDFIKSGYLDYRLQKIVDPHLIDVSYQGEEGIREALEKADDVV
QLSLYRETMNAFENFKLHLAKGTGLAIYGPDDLERALDMGAVAVLLVHEDRQDVDKWKER
AESMGAKVYIIPESLPESEWFLKTFDGLAGILRYKVDLSSQQG
Download sequence
Identical sequences D9Q048
gi|302348079|ref|YP_003815717.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]