SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302348587|ref|YP_003816225.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348587|ref|YP_003816225.1|
Domain Number 1 Region: 12-190
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 8.35e-50
Family GHMP Kinase, N-terminal domain 0.00000359
Further Details:      
 
Domain Number 2 Region: 192-360
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.7e-40
Family Galactokinase 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302348587|ref|YP_003816225.1|
Sequence length 367
Comment Galactokinase [Acidilobus saccharovorans 345-15]
Sequence
MGRPQGPRRLNMITVRSPGRVNIIGEHTDYALGYVMPMAIQLGTTFTAEPSLDERTCIFS
EAMKEELCFGDELVREGRWIDYVKGVYYAIRSRGLRYMHVSGRLSGDLPMSSGLSSSASL
EMAIAVAQNELARLGLSRLELARLGVTAENEFLGIPSGILDQFAAVMGKEGKAVFTDTET
LNYEYVPIPEDVEFLVFHTGIRRAVAGTEYSERVKVVKSALRALGVSSSKYVREEQLSRL
DELQRKRLGYVIRENSRVLAVRDALRSGDVVTTGRILTEAHWDLARNYEVSVPELDFFVE
FATSHGAYGARLTGAGFGGAAIALVDRGKGEQLGREAEEEYVRRFPHRPQHWVVTPAEGA
RVIDVRP
Download sequence
Identical sequences D9Q1K6
gi|302348587|ref|YP_003816225.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]