SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302348726|ref|YP_003816364.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348726|ref|YP_003816364.1|
Domain Number 1 Region: 95-118,170-415
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.39e-61
Family D-glucarate dehydratase-like 0.00011
Further Details:      
 
Domain Number 2 Region: 5-107
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 1.54e-21
Family Enolase N-terminal domain-like 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302348726|ref|YP_003816364.1|
Sequence length 421
Comment gluconate dehydratase (GAD) [Acidilobus saccharovorans 345-15]
Sequence
MKELRITKVTSFTVQANFEWTFVRVYSGDLYGTGEAGPTPGASAIANTLGSVIVGEDTFK
VNRILQKLRWATLYAGTSAYHIISAIDMAIYDLIGKYLNLPVYALLGGDRTEIPVYVDAH
GGKGLEAMNSALMPVEPPWISQANVEKGRIKEPSPVHGRLTAEAWTSDYTPEAYASRARE
LKAEGWKAIKFDLDVPTPHSDPVRLRSGRLSQAEVQYLAALAEAVRDAVGYDVDIMFDLH
WRYDLNTGIALCRALESVKPRWVEDPTPAVTTLTNLDELRMITSRCNVPIEVGENLYTYY
QFKDLLGTGVSVWAPDPAKAGGITELRRIEELASLYDIEVSPHNIGSPIATMAAAHAASV
SNTFGALEFHGHDLPFWNDLVKSKKRIIDASRSAIVLTDEPGLGVELDEEVAARLWPGFE
L
Download sequence
Identical sequences D9Q1Z5
WP_013266845.1.78912 gi|302348726|ref|YP_003816364.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]