SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302348776|ref|YP_003816414.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348776|ref|YP_003816414.1|
Domain Number 1 Region: 168-427
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.19e-67
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00000999
Further Details:      
 
Domain Number 2 Region: 18-166
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 7.19e-49
Family Malic enzyme N-domain 0.00000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302348776|ref|YP_003816414.1|
Sequence length 446
Comment Malate dehydrogenase [Acidilobus saccharovorans 345-15]
Sequence
MSEGEPATEEWYSLSINMHRFYGGKIEVLPKVPVRGLKDLAVWYTPGVAAVSRLISSDPD
LSFELTSRWNTIAVVSDGTRVLGLGKVGPEAAYPVMEGKALLFKYLGGVDAVPIVHRFSK
AEDFVRFLEAIEPSFGGINLEDIEKPKCFTILDEARSKLQIPVWHDDQQGTATAILAGLI
NALKVVGKKLQDVRIVIFGVGAANTAFYRLLKYMGVKPNHIVAVDKNGVLHPEMKDIDKL
MLTDPYQYQIAIETRGGGLPPDSPIEKAFEGADVVVAASAPGPGVIRPEWVSRMNRDAVV
FALANPVPEIWPSEARRAGARVVATGRSDFPNQVNNSLVFPAVFRGVLDVRARTITDTMA
IAAAVELAKFAEERGGIGEDRILPTMEEWEVYPRVAAAVAVKAVEEGVARRTTTYREELE
RATEIIGTVRQKINALLDKGLITMPM
Download sequence
Identical sequences D9Q245
gi|302348776|ref|YP_003816414.1| WP_013266895.1.78912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]