SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|302348808|ref|YP_003816446.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348808|ref|YP_003816446.1|
Domain Number 1 Region: 10-161
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 1.77e-33
Family Ribosomal protein S4 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302348808|ref|YP_003816446.1|
Sequence length 177
Comment 30S ribosomal protein S4P [Acidilobus saccharovorans 345-15]
Sequence
MGDPKKSRHKWLTPGHPWIKDRLQHELELIGKYGLRNKREVWIAESIVRNFRLRARSLLA
LPEQERSIAAKNLLDTLYRMGLVGKDAVLDDVLGLTAENVLERRLQTLVYRKGLAKTIYQ
ARQLVTHGHIAINGRRVTSPGYIVPRDEEDRIEIAPGSPLRASAQQSGGEQDVAQGA
Download sequence
Identical sequences D9Q277
WP_013266927.1.78912 gi|302348808|ref|YP_003816446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]