SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302348836|ref|YP_003816474.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302348836|ref|YP_003816474.1|
Domain Number 1 Region: 13-135,251-405
Classification Level Classification E-value
Superfamily Substrate-binding domain of HMG-CoA reductase 5.62e-85
Family Substrate-binding domain of HMG-CoA reductase 0.00000466
Further Details:      
 
Domain Number 2 Region: 138-253
Classification Level Classification E-value
Superfamily NAD-binding domain of HMG-CoA reductase 1.57e-36
Family NAD-binding domain of HMG-CoA reductase 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|302348836|ref|YP_003816474.1|
Sequence length 419
Comment 3-hydroxy-3-methylglutaryl-coenzyme A reductase [Acidilobus saccharovorans 345-15]
Sequence
MYLMSNEELSSKVEEALSKLESGELSFSKLDSFLGNPNLAALVRRLFLERKYNVRLTSIA
STVIDFVGVVGHNIENPIGAAQIPLGVVGPLKVQGDYARGEFYVPMATTEGALVAGVNRG
VKAVTMSGGARSKVLYDGMTRAPIIWTPSVVEAQSLASWIKGNIGALREEVKKVTRHGEL
VDVQTYIVGNILWPRFVFRTGDAMGMNIATIASDLLCSYIDEHYKGEHRCLSVSGNLCSD
KKPSSINRLLGRGKYVVSEAIVKGDVLRDLMRTTPESVDFINKSKNLLGNAVAGSPSFNG
HVANIIAAIFIATGQDVAQVVESSMAYTWTEVRGNDLYISVTLPSLEVGTVGGGTWLPTQ
REALELLGVAGGGNPPGVNALKLAEIVAAVALAGELNLLASQVTGELAKAHERLGRGRG
Download sequence
Identical sequences D9Q2A5
gi|302348836|ref|YP_003816474.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]