SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302348901|ref|YP_003816539.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|302348901|ref|YP_003816539.1|
Domain Number - Region: 107-210
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 0.034
Family Band 7/SPFH domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|302348901|ref|YP_003816539.1|
Sequence length 223
Comment 30S ribosomal protein S3 [Acidilobus saccharovorans 345-15]
Sequence
MPRPKVATRESWRIKKWYDVVAPESLGGMVIASVPALDPSYLPGRTVEITLYDITGDFTH
VNTKLKFQIYGVDGTTAKTFVKGVELMRDYLRSLTRRKSSKIALIHKLTTKDGVTVRVTA
VTWTQFRCKSSQKRSIRLLMKEVLESKVPQMTFDDFVKAAVFSDQEGSLAQEITARVRKI
CSIRKVEIAKVKVLTPPSYATSIAAVPTAQQAVKAGQQSAVVS
Download sequence
Identical sequences D9Q2H0
WP_013267020.1.78912 gi|302348901|ref|YP_003816539.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]