SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|302349091|ref|YP_003816729.1| from Acidilobus saccharovorans 345-15

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|302349091|ref|YP_003816729.1|
Domain Number 1 Region: 33-128
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000759
Family Multidrug resistance efflux transporter EmrE 0.011
Further Details:      
 
Domain Number 2 Region: 183-269
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000222
Family Multidrug resistance efflux transporter EmrE 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|302349091|ref|YP_003816729.1|
Sequence length 274
Comment hypothetical protein ASAC_1293 [Acidilobus saccharovorans 345-15]
Sequence
MAVSVGVAFGVHDAVAKMKLEGADPSLLSFSTLLAGLPLLAIVLPFAGGLRLTLASAGLF
IVAGIVNFSVGRTLMYAATSRLSSSGASVMTSSSAAFSILMSLILGERVTPSIVLGVVAI
MAGVYLASDWGTERFSLSGLGLGLATGFAIASSVAIIKLGDLYGGSPGLGVIIAYLSGLV
ALSPRASLGLLRRSGKPVAIMGLAAALGQLLRYVALTSLEVDVVTPLQNLRPIVTTALLY
GATREAGKHPMIRHWVAACVAFLGILLVSGTIAL
Download sequence
Identical sequences D9Q310
gi|302349091|ref|YP_003816729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]