SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15606757|ref|NP_214137.1| from Aquifex aeolicus VF5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15606757|ref|NP_214137.1|
Domain Number 1 Region: 24-176
Classification Level Classification E-value
Superfamily Ligand-binding domain in the NO signalling and Golgi transport 9.42e-26
Family MJ1460-like 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15606757|ref|NP_214137.1|
Sequence length 182
Comment hypothetical protein aq_1655 [Aquifex aeolicus VF5]
Sequence
MLSYWTQGKFFICRGQGMVGIKDQIKALTEAIERESVLIHRDALIGAYRDLKKVAKFGLD
KLIKKAAEYGGRKGAKTLKEKYAIYTDRLDEAMDVLSIIAESSRMIGYFDYDPKAMEIKI
EGSILVEAIPKSDKPVCEPMAGFFKGFLSEFLEKDYEVKEVQCQAQGYEQCVFRIRQKGA
KK
Download sequence
Identical sequences O67571
224324.aq_1655 gi|15606757|ref|NP_214137.1| NP_214137.1.100253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]