SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|15606806|ref|NP_214186.1| from Aquifex aeolicus VF5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15606806|ref|NP_214186.1|
Domain Number 1 Region: 204-384
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.05e-71
Family B3/B4 domain of PheRS, PheT 0.0000105
Further Details:      
 
Domain Number 2 Region: 461-669
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.46e-36
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00019
Further Details:      
 
Domain Number 3 Region: 676-774
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 7.59e-29
Family Anticodon-binding domain of PheRS 0.0012
Further Details:      
 
Domain Number 4 Region: 35-192
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.85e-28
Family Myf domain 0.0031
Further Details:      
 
Domain Number 5 Region: 396-467
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000266
Family Domains B1 and B5 of PheRS-beta, PheT 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15606806|ref|NP_214186.1|
Sequence length 775
Comment phenylalanyl-tRNA synthetase subunit beta [Aquifex aeolicus VF5]
Sequence
MKVPYSWLSEFVELSDVSPEEIAEKLSLRSVEATVETFGIDLDGVVFGKVVEVKEHPTKK
KLAVVKVQVQEHIFIDVVTVDKSVREGDGVIVALPNAKVGNMCVTEREFDGVVSKGLLLS
AQELGLEEKSEGVLKIHEDFKPGTDANEILGFGEKIIEIDITPNRGDMLSVRGVARDLSA
IFRLPKKKPEEPTYEETGEFFIEIEDEDCKRYRGVVIEGVEIKESPLYIKKRLWQCGIKS
INNVVDITNYVMLRDGQPLHAFDLSKVEGGIIVRSAKKGEKIITLDGEERELDEDILVIA
DREKPLAVAGVIGGLESGIKENTKDILLESAYFNPFRVRKASKKLGIQTESSYRFERNVD
IERVDRAQDYAVYLILKHAGGKVKVVKDVYREKYKPKKVFLPQGKYIRYAGESYKNEEVK
EILDALEIPNEIMRCGVEVLVPSHRSFDIQRDVDLIEEIMRVKGYEHYTSETLKLPSIAN
LWKDNLLEVKKYLRDKGLTEVINFSFEDSKLYELLNLPLPELEVINPLNPTQRYMRNTLI
TSLLRTAVYNDRNYNYDQAVFELGKVFFKEGEENRLGILLKGNKPRTLKEEKWEPYDLTE
IIAGIFALFGLEPEFRNAKRNFLHPYVQGEVYLEGEFVGFFGKLHPKIAKELELKGEPFV
AEIEIERVLSKKRLPHYREVAKFPPVVRDIALVMDKELDVNKLLIDTKSQIGELLEEVRV
FDVYTGEKVGEGKKSVAVRLVLRSKTGSLKDEEANELVNKLVNYLKEKYGVELRT
Download sequence
Identical sequences O67620
gi|15606806|ref|NP_214186.1| NP_214186.1.100253 224324.aq_1730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]