SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|527317759|ref|YP_008343963.1| from syncytium symbiont of Diaphorina citri

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|527317759|ref|YP_008343963.1|
Domain Number 1 Region: 120-286
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.97e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00037
Further Details:      
 
Domain Number 2 Region: 408-548
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.01e-37
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00066
Further Details:      
 
Domain Number 3 Region: 1-126
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.41e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.012
Further Details:      
 
Domain Number 4 Region: 252-276,315-421
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 4.25e-23
Family Duplicated SiR/NiR-like domains 1 and 3 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|527317759|ref|YP_008343963.1|
Sequence length 550
Comment sulfite reductase subunit beta [Candidatus Profftella armatura]
Sequence
MYHYDKYDHQLVKERVIQYRDQVRRRLSNELSEEEFIVLRLQNGLYLQRYAYMLRIAIPY
GMLSSKQMRMLSYIAKKYDRNYGHFTTRQNIQFNWIKLKESPDILENLASVEMHAIQTSG
NCIRNITSDELSGVSFDEIIDTRPYAEILRQWSTFHPEFAYLPRKFKISISGSQEDRAAI
FVHDIGLRAIKNKLGKIGFCVIVGGGMGRTPIIGQIICKFLPWKHILTYIEAILRIYNQY
GRRDNIYKSRIKILLKSIGIENFQFQVNEEWKNIKNGPSTLTLEELKRVKKYFITPKYKT
LPKNSIILKEKCKHNKEFENWVHQNTKEHKINGYIIVILSLKRINMAPGDITSEQMNFVA
NLADHYSFSELRVTHTQNIVLSDVTKDNLFNLWTEIKQYGLSESNINLLTDIICCPGGDF
CSLANTKSLPIAKNIMKYFSKDDQRNIGKISLNISGCINSCGHHHIGNIGILGLNKNGNE
YFQILIGGSQGNKLNFGKIIGPSFSADQVPDIINRILKVYLRYRIKNEYFINTVKRIGIT
LFKENVYKNI
Download sequence
Identical sequences S5R484
gi|527317759|ref|YP_008343963.1| WP_020915594.1.11600 WP_020915594.1.89615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]