SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|11498114|ref|NP_069339.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11498114|ref|NP_069339.1|
Domain Number 1 Region: 77-125
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.000000803
Family Cytochrome c3-like 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|11498114|ref|NP_069339.1|
Sequence length 145
Comment hypothetical protein AF0503 [Archaeoglobus fulgidus DSM 4304]
Sequence
MSEMYNKKYVIPLILVFLIGFFTPYWYNAMAGTLGHVPTLKEPAGNCVEDKDWMAANHML
LLQQWRTQAIRHGAEGGGIYHSFTTGEEYHASTNTCWSCHDSKEEFCDQCHDYVGIHPEC
WDCHYTPSVEKPHYSGIEELSKYFS
Download sequence
Identical sequences AF0503_1_145 224325.AF0503 gi|11498114|ref|NP_069339.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]