SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|11499315|ref|NP_070554.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11499315|ref|NP_070554.1|
Domain Number 1 Region: 34-285
Classification Level Classification E-value
Superfamily SPOC domain-like 6.67e-53
Family Ku80 subunit middle domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|11499315|ref|NP_070554.1|
Sequence length 286
Comment hypothetical protein AF1726 [Archaeoglobus fulgidus DSM 4304]
Sequence
MFLHDTYLILIFVFKFIMLMEKSVFYRARLRLSMRATWKGSISFGLVNIPVKVYKATTQK
EIQFHLLHSADGGRIRYRKVCEKCGKEVSDGEIVKGYEISKNEYVILTDEDFEKIPLKST
KSIEIRQFFDPAELGLIYYSSFYYISPDKGGEKAYYLLKKAMEETNSMGIGKMTMRGKEN
LVALRPYDGGIVLAQLHYIDEVRSPLELPGWGAVAEITEEELELAKKLILAMKKPLKLEE
FRDEYKEALMQLIEAKLSGREIVVSEGVEEVKSLIDALKASLEAVK
Download sequence
Identical sequences APC61988 gi|11499315|ref|NP_070554.1| 224325.AF1726 WP_010879222.1.27515 WP_010879222.1.34637 WP_010879222.1.46508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]