SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|11499385|ref|NP_070624.1| from Archaeoglobus fulgidus DSM 4304

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|11499385|ref|NP_070624.1|
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily SIS domain 1.5e-42
Family mono-SIS domain 0.0000000327
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|11499385|ref|NP_070624.1|
Sequence length 183
Comment hypothetical protein AF1796 [Archaeoglobus fulgidus DSM 4304]
Sequence
MLRFLEVVSEHIKNLRNHIDLETVGEMIKLIDSARSIFVIGAGRSGYIAKAFAMRLMHLG
YTVYVVGETVTPRITDQDVLVAISGSGETTSVVNISKKAKDIGSKLVAVTGKRDSSLAKM
ADVVMVVKGKMKQERDEILSQLAPLGTMFELTAMIFLDALVAEIMMQKHLTEKDLEARHA
VLE
Download sequence
Identical sequences A0A075WG66 A0A101E1S9 O28478
gi|11499385|ref|NP_070624.1| 224325.AF1796 WP_010879292.1.27515 WP_010879292.1.34637 WP_010879292.1.46508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]