SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AGAP000166-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP000166-PA
Domain Number 1 Region: 3-133
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.44e-35
Family Insect phospholipase A2 0.0000546
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP000166-PA   Gene: AGAP000166   Transcript: AGAP000166-RA
Sequence length 134
Comment pep:novel chromosome:AgamP3:X:2853227:2854606:-1 gene:AGAP000166 transcript:AGAP000166-RA
Sequence
KAIYPGTVWCGDGNQAKSENDIGFFYLTDSCCRAHDLCPITIAAGEQFNRLKNNGYFTRS
HCDCDKQFFNCLKNANTLVSRQIGYTYFNLLKPQCFRHEHPKLNCTKRSKGKCISYVVDE
KQSKRWQWFDNLIF
Download sequence
Identical sequences 7165.AGAP000166-PA AGAP000166-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]