SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AGAP002402-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP002402-PA
Domain Number 1 Region: 3-267
Classification Level Classification E-value
Superfamily CutC-like 3.66e-57
Family CutC-like 0.0000111
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP002402-PA   Gene: AGAP002402   Transcript: AGAP002402-RA
Sequence length 270
Comment pep:novel chromosome:AgamP3:2R:20960312:20961211:-1 gene:AGAP002402 transcript:AGAP002402-RA
Sequence
MQILLEVCVDTFESAVAAIQGGADRIELCSALSEGGLTPSVGLLREIKQYLAAEYAAPLL
SGRPTIFPVYCMIRCRRGSDFCYSAQEMNAMLWDMRLLKQNGADGFVFGALDPSSSGRVH
RQHCEQVVVAAGELPLTFHRAIDCTEEGALGENLKLIAELGFSTVLTSGLKPTAEQGMET
ITKMKEIADQLTGKSLRVMPGSGVSTQNARQILQRTGCDAIHGSASITKPAGGHQTGTIS
MGGSNVDAMPLKVCSKAKVQELRQLIDSLV
Download sequence
Identical sequences Q7QC16
XP_312550.4.40869 AGAP002402-PA AGAP002402-PA|hypothetical 7165.AGAP002402-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]