SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AGAP011569-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP011569-PA
Domain Number 1 Region: 10-133
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 1.15e-35
Family Insect phospholipase A2 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP011569-PA   Gene: AGAP011569   Transcript: AGAP011569-RA
Sequence length 137
Comment pep:novel chromosome:AgamP3:3L:27938405:27946545:1 gene:AGAP011569 transcript:AGAP011569-RA
Sequence
HKRAISDWFLSPNTKWCGKGHSASEYRQLGGASRADMCCRTHDHCKYMIPPMSTNFQTFN
IRPFTISHCACDSRFRTCLKLADSKDANLVGKLFFNVMQMKCFVFKPETVCTKKSWWGTC
ERKGRRKRAVLRHNRKF
Download sequence
Identical sequences Q7QGJ7
XP_309938.3.40869 AGAP011569-PA 7165.AGAP011569-PA AGAP011569-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]