SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AGAP000865-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP000865-PA
Domain Number 1 Region: 1262-1431
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.0000986
Further Details:      
 
Domain Number 2 Region: 714-910
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-38
Family DBL homology domain (DH-domain) 0.00055
Further Details:      
 
Domain Number 3 Region: 926-997,1053-1088
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000289
Family Pleckstrin-homology domain (PH domain) 0.044
Further Details:      
 
Domain Number 4 Region: 1149-1218
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000203
Family Synaptotagmin-like (S variant) 0.041
Further Details:      
 
Weak hits

Sequence:  AGAP000865-PA
Domain Number - Region: 7-61
Classification Level Classification E-value
Superfamily Bcr-Abl oncoprotein oligomerization domain 0.0759
Family Bcr-Abl oncoprotein oligomerization domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP000865-PA   Gene: AGAP000865   Transcript: AGAP000865-RA
Sequence length 1462
Comment pep:novel chromosome:AgamP3:X:16104446:16138308:-1 gene:AGAP000865 transcript:AGAP000865-RA
Sequence
MSVFGDFQRMWVQRFPQSSLSDAWEQDVRASLERHKQKIAVLSKELEQETLYVEYLERLL
GDVEKYREAGGDPSTLFEANSPASAANLLAGGGQLRDSLPGHGDGAHEPDEEEVLRSREL
PPNRNNNSPLNQCINELTTNLHSRRCVSELVAASSSSSSTATSATTNPINAGEPAHQSTA
AGGPAQQSTSNGPQPTANGGTPGHDVAGKEAAGRVRSASQSEAQQPLLASPSHFVTVIEV
KESKGNGGSGASVGGASDKSPQDSETPSAPKTANYENVLINTGARFGGSLLGASAAADHK
KKVPPRPPPKYVRRAAPVEPPTVPSMAMQNLRNKDAGPIHSTPEPATGTAPDSPSVTSSS
LERNIKPSEMYRQKSSDSLDVKLSSVGYGHDQPGKARLPKSDSLKSKSSSTDSPTGSLGK
VASGTPGIGASPTGSLGKLPTSMTGSSSDSPTGSLGKMNQQQHHHHQTPPYTSQHSYQQR
HGTDGGLPHVDSKESLASGGGGTGTIGSTGAIGPISERIKSYESISSLSSDSMRQQNPKD
QEHYYDTVPLDNSDGDYVYIQPGGVGTGSTSSRDDISTVENASTLLMPSHPRSHNSSQTS
VQLEPESPGRSSNYVNIEYFIHQNNENRSSSIDSDGEGDGGAPVLMRAISTDTDAGSGVV
GTVGARRRYIQRKWPIPQGFGKCVDKATFFSHIAEDRKKTYCTFSRFQNANRDTIIRRIV
TSIITSETLYVECLNKMKQYMKAIRATLTTSQPVISEEEFQTIFFKIEDLHEVHSEFLTE
LQARLAAPDEPGSPDGGGLCVGEPFRRLATQIHLYGAFLHNYGRAIDTVKMCSTHSQQFK
EIVSNIVFKNQNEQKLSLEELLHKPVARVQKNALVLEDLLNQTPEQHPDYHPLRQASKTI
RNFLSEFNVVQTRSMFPVRSDDKALRRLVKNSFIVELADGHRKLRHLLLFNDVIACAKYK
AVGRAGDRNGFEFELKWYIPLRDILICEESANDPKEASPINIVHLKSQACTVRDQIMLDE
KDRPGGSSRAGDKHRKKLADLEAQLVLASPNLVFKIGNKATGKTMTFFLSSDFERTQWIE
SILSLQQSCNLPGHIPVQIYDLHAWITACQSLIKTEMGSYLMRNARDESLLVGDLHLTIQ
GLSGFDQPCDLFVCVEIDSYGHYFRKAKTKLVCRSATPQWNESFVLELEGSQNLRILLYQ
DDVQRPILRAKHILKLSRSWMQETPTRKVLQLSETLSISTIIRFVPGEVTLRRVPTSKPG
ALFGAKLQQVIKREKRDIPFIVSACVREVERRGMTEVGIYRVSGSASDVAKLKKSFETNA
YEAEQLLKEVDIHSVTGILKSYLRDLPEALFTDQYYPKLFDAFNRHSNLSEGTRIHELQR
IFAELPQPNKATINLLLDHLMRVHQQEIENKMSLHNLAMVFGPTLLRPGPSATKQKDLLE
SSTADVMTQAGILYSFLQARLK
Download sequence
Identical sequences 7165.AGAP000865-PA AGAP000865-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]