SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AGAP005719-PA from Anopheles gambiae 49_3j

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AGAP005719-PA
Domain Number 1 Region: 167-269
Classification Level Classification E-value
Superfamily TAFH domain-like 1.96e-29
Family TAFH domain-like 0.0007
Further Details:      
 
Domain Number 2 Region: 670-719
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000126
Family TBP-associated factors, TAFs 0.0081
Further Details:      
 
Weak hits

Sequence:  AGAP005719-PA
Domain Number - Region: 748-807
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 0.0628
Family Troponin T 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: AGAP005719-PA   Gene: AGAP005719   Transcript: AGAP005719-RA
Sequence length 879
Comment pep:novel chromosome:AgamP3:2L:19582843:19592997:1 gene:AGAP005719 transcript:AGAP005719-RA
Sequence
MHRQPGSTLLLKNEQGQFQLLRIGPAPAGTQITPAGLTGSSANQTIRLQTVPATHSSGSG
AIIVSSQSITTTPASYISTQPTPVASVAPVPALAAQQNITITHSPSQVGGQPTVLAAQQQ
QQQQTTTVVATPHSVGQQQSQQQQQQQTVVVTTTPGTTPAQQRNSLDNTKEKCSKFLTNL
IELSKREPAKVEQNVRTLIQELVDANVDPAEFCERLERLLNASPQPCLIGFLKAQIRPVA
PTIVSQNSMVGQTQIRMLTSQSGVTTVPRIGQTTIRPAAPVRIQTPLQQQQQPGGGTTTT
IVGPRSITAQQIRPNATTIGHTTIVQTAGGQQLPQTISTTPPALLPIRAPSGTSITRTGA
TLQIRTTTPVSRTVTSVGGTTVTTGGLGKQLLQSQVNQIRGQTPVASVAAVAAAAAAAAS
GTTATQVKQVTAITGGGNVVVSLNQVPPPMQPVSGNASIIGGTAVSLVPTMPALTLTSSA
VSAVGLSAAGIVSSSSASSSSASSSSSAATTVGPPGGISATVVVNSVPSATPAAAVASAA
APPTGTTSIGTAASGVGGASSSSSSSAATVTTVSTNKTVTAKSQNLSGASKKKAGAASAA
SGPDAESAASKRAGASAQSQFYHHHASMYGDDDINDVAAMGGVNLAEETQRILGSTEFVG
TQIRSCKDEVFLHLPALQSRIRAIIARHGLEEPSNEVAVLISHACQERLKNVVEKLAIIA
EHRIDIIKVDPRYEVTKDVRGQIKFLEELDKAEQKRHEEQEREMLMRAAKSRSKTEDPEQ
AKLKAKAKEMQRAEMEELRQRDANLTALQAIGPRKKPKLEEGASASTTPGVSGISTLSGK
APTPLRPRIKRVNLRDMLFYLEQERETGKSQMLYKAYLK
Download sequence
Identical sequences Q7Q6R0
7165.AGAP005719-PA AGAP005719-PA XP_315737.4.40869 AGAP005719-PA|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]