SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332980940|ref|YP_004462381.1| from Mahella australiensis 50-1 BON

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332980940|ref|YP_004462381.1|
Domain Number 1 Region: 22-96
Classification Level Classification E-value
Superfamily Apolipoprotein 0.0000811
Family Apolipoprotein 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332980940|ref|YP_004462381.1|
Sequence length 128
Comment hypothetical protein Mahau_0343 [Mahella australiensis 50-1 BON]
Sequence
MNKKIFMIVAVIAVLIVAAATALAADEQPEVQQPAQSADAQLTPQQQQEIDALYEQMQDI
RNKIIDKYAEYGTITDAQAEQAKANSEIMIERMKERAAEGFAGCGAGYGMRAGRGRGAGF
GNNASAVQ
Download sequence
Identical sequences F3ZXQ2
WP_013779992.1.64305 gi|332980940|ref|YP_004462381.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]