SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332981579|ref|YP_004463020.1| from Mahella australiensis 50-1 BON

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|332981579|ref|YP_004463020.1|
Domain Number - Region: 75-147
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00602
Family Apolipoprotein 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332981579|ref|YP_004463020.1|
Sequence length 152
Comment H+-ATPase subunit H [Mahella australiensis 50-1 BON]
Sequence
MDDVMALLERLEDELESGNNLPFTSKTMINREQCLELIKEIRIRLPDDFKQAQVVVAEKN
SIIADAQRQAEAILQDAESQFKLMVDQHEITKKAYEQAREIISNAQKNAREIRLGANDYA
DEVLGRLDAYVSRLLDDIRKDRAELKKGHHQS
Download sequence
Identical sequences F4A2L8
WP_013780628.1.64305 gi|332981579|ref|YP_004463020.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]