SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332982974|ref|YP_004464415.1| from Mahella australiensis 50-1 BON

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332982974|ref|YP_004464415.1|
Domain Number 1 Region: 37-149
Classification Level Classification E-value
Superfamily Apolipoprotein 0.000000000458
Family Apolipoprotein 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|332982974|ref|YP_004464415.1|
Sequence length 174
Comment hypothetical protein Mahau_2431 [Mahella australiensis 50-1 BON]
Sequence
MIEEAKAMDEGKKDELKEKTAGYNYEEPIDFRPNRIDDRLNRLDQKIDGLRTDLTAEIKE
LRTDMTAEIKELRADMTAENKELRADMTAEIKGLRADMTVEIKEVRTSTERTRTDLTAEI
KGLRADMTAENKELRADMTAEIKDIQKGLSKNLMWTVGTVIAGMAAMIGFIKLL
Download sequence
Identical sequences F3ZWX1
gi|332982974|ref|YP_004464415.1| WP_013782019.1.64305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]